OriGene Logo

Cd160 (NM_018767) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG216467
Cd160 (tGFP-tagged) - Mouse CD160 antigen (Cd160) transcript variant 2, (10ug)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP tGFP DDK
AAV Particle:
DDK
  $500.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Cd160 or NM_018767"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Cd160
Synonyms AU045688; By55
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG216467 representing NM_018767
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAAAGAATCCTGATGGCCCCTGGCCAAAGCTGCTGTGCCCTGGCCATCCTGCTGGCAATTGTGAACT
TCCAACATGGTGGATGTATTCATGTCACCAGCTCAGCATCCCAGAAAGGAGGGCGACTGGACCTCACCTG
TACTTTGTGGCACAAGAAAGACGAAGCTGAGGGGCTAATACTCTTCTGGTGCAAAGACAATCCTTGGAAC
TGTTCCCCTGAGACCAGCTTAGAACAGCTTAGGGTTAAAAGGGATCCTGAGACAGATGGCATCACTGAAA
AGTCATCTCAGTTGGTGTTCACCATAGAACAAGCTACACCATCAGACAGTGGGACCTACCAGTGCTGTGC
CAGAAGCCAGAAACCAGAAATCTACATTCATGGCCACTTTCTCTCCGTTCTAGTCACAGGGAACCACACA
GAGATAAGACAGAGACAAAGGTCACACCCTGACTTCAGCCATATCAACGGCACTCTCAGTTCAGGCTTCC
TGCAAGTAAAGGCTTGGGGGATGTTGGTCACCAGCCTGGTGGCCCTTCAAGCTCTATATACCTTG

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG216467 representing NM_018767
Red=Cloning site Green=Tags(s)

MQRILMAPGQSCCALAILLAIVNFQHGGCIHVTSSASQKGGRLDLTCTLWHKKDEAEGLILFWCKDNPWN
CSPETSLEQLRVKRDPETDGITEKSSQLVFTIEQATPSDSGTYQCCARSQKPEIYIHGHFLSVLVTGNHT
EIRQRQRSHPDFSHINGTLSSGFLQVKAWGMLVTSLVALQALYTL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_018767
ORF Size 555 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018767.2
RefSeq Size 2513 bp
RefSeq ORF 558 bp
Locus ID 54215
UniProt ID O88875
Cytogenetics 3 F2.1
Summary CD160 antigen: Receptor on immune cells capable to deliver stimulatory or inhibitory signals that regulate cell activation and differentiation. Exists as a GPI-anchored and as a transmembrane form, each likely initiating distinct signaling pathways via phosphoinositol 3-kinase in activated NK cells and via LCK and CD247/CD3 zeta chain in activated T cells (By similarity). Receptor for both classical and non-classical MHC class I molecules (PubMed:16177084). Receptor or ligand for TNF superfamily member TNFRSF14, participating in bidirectional cell-cell contact signaling between antigen presenting cells and lymphocytes. Upon ligation of TNFRSF14, provides stimulatory signal to NK cells enhancing IFNG production and anti-tumor immune response (PubMed:25711213). On activated CD4+ T cells, interacts with TNFRSF14 and downregulates CD28 costimulatory signaling, restricting memory and alloantigen-specific immune response (By similarity). In the context of bacterial infection, acts as a ligand for TNFRSF14 on epithelial cells, triggering the production of antimicrobial proteins and proinflammatory cytokines (PubMed:22801499).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_018767" in other vectors (5)
SKU Description Size Price
MC205782 Cd160 (untagged) - Mouse CD160 antigen (Cd160), transcript variant 2, (10ug) 10 ug
$300.00
MG201707 Cd160 (tGFP-tagged) - Mouse CD160 antigen (Cd160) 10 ug
$500.00
MR216467 Cd160 (Myc-DDK-tagged) - Mouse CD160 antigen (Cd160), transcript variant 2 10 ug
$289.00 $300.00
MR216467L3 Lenti ORF clone of Cd160 (Myc-DDK-tagged) - Mouse CD160 antigen (Cd160), transcript variant 2 10 ug
$600.00
MR216467L4 Lenti ORF clone of Cd160 (mGFP-tagged) - Mouse CD160 antigen (Cd160), transcript variant 2 10 ug
$600.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.