OriGene Logo

Emp2 (NM_007929) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG216001
Emp2 (tGFP-tagged) - Mouse epithelial membrane protein 2 (Emp2), (10ug)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
  $650.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (3)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Emp2 or NM_007929"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Emp2
Synonyms XMP
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG216001 representing NM_007929
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGGTGATTCTTGCCTTCATCATTGTCTTCCACATCGTGTCCACGGCACTCCTGTTCATTTCTACCA
TTGACAATGCCTGGTGGGTAGGCGACAGCTTCTCTGCTGACCTCTGGAGAGTGTGCACCAACAGCACAAA
CTGTACCGAGATCAATGAGCTGACCGGCCCTGAAGCGTTTGAAGGTTATTCTGTGATGCAGGCGGTGCAG
GCCACCATGATCCTCTCCACCATCCTCTCCTGCATCTCCTTCCTCATCTTTCTGCTCCAGCTCTTCCGCC
TCAAGCAGGGAGAGAGGTTCGTCCTGACGTCCATCATCCAGCTCATGTCCTGTCTGTGTGTCATGATCGG
AGCTTCCATCTATACAGACCGGCGCCAAGACCTTCACCAACAGAACAGAAAACTCTATTACCTACTGCAA
GAAGGCAGCTACGGCTACTCTTTCATCCTGGCCTGGGTGGCCTTTGCCTTCACTTTCATCAGCGGCCTCA
TGTACATGATCCTGAGGAAGCGTAAA

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG216001 representing NM_007929
Red=Cloning site Green=Tags(s)

MLVILAFIIVFHIVSTALLFISTIDNAWWVGDSFSADLWRVCTNSTNCTEINELTGPEAFEGYSVMQAVQ
ATMILSTILSCISFLIFLLQLFRLKQGERFVLTSIIQLMSCLCVMIGASIYTDRRQDLHQQNRKLYYLLQ
EGSYGYSFILAWVAFAFTFISGLMYMILRKRK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_007929
ORF Size 516 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007929.2, NP_031955.2
RefSeq Size 3440 bp
RefSeq ORF 519 bp
Locus ID 13731
UniProt ID O88662
Cytogenetics 16 5.54 cM
Summary Functions as a key regulator of cell membrane composition by regulating proteins surface expression. Also, plays a role in regulation of processes including cell migration, cell proliferation, cell contraction and cell adhesion. Negatively regulates caveolae formation by reducing CAV1 expression and CAV1 amount by increasing lysosomal degradation (PubMed:17609206, PubMed:14978215). Facilitates surface trafficking and the formation of lipid rafts bearing GPI-anchor proteins (PubMed:14978215). Regulates surface expression of MHC1 and ICAM1 proteins increasing susceptibility to T-cell mediated cytotoxicity (PubMed:12763482). Regulates the plasma membrane expression of the integrin heterodimers ITGA6-ITGB1, ITGA5-ITGB3 and ITGA5-ITGB1 resulting in modulation of cell-matrix adhesion (PubMed:12189152). Also regulates many processes through PTK2. Regulates blood vessel endothelial cell migration and angiogenesis by regulating VEGF protein expression through PTK2 activation (By similarity). Regulates cell migration and cell contraction through PTK2 and SRC activation (By similarity). Regulates focal adhesion density, F-actin conformation and cell adhesion capacity through interaction with PTK2 (By similarity). Positively regulates cell proliferation (By similarity). Plays a role during cell death and cell blebbing (By similarity). Promotes angiogenesis and vasculogenesis through induction of VEGFA via a HIF1A-dependent pathway (By similarity). Also plays a role in embryo implantation by regulating surface trafficking of integrin heterodimer ITGA5-ITGB3 (PubMed:16487956, PubMed:16216233). May play a role in glomerular filtration (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_007929" in other vectors (4)
SKU Description Size Price
MC208436 Emp2 (untagged) - Mouse epithelial membrane protein 2 (Emp2), (10ug) 10 ug
$480.00
MR216001 Emp2 (Myc-DDK-tagged) - Mouse epithelial membrane protein 2 (Emp2) 10 ug
$450.00
MR216001L3 Lenti ORF clone of Emp2 (Myc-DDK-tagged) - Mouse epithelial membrane protein 2 (Emp2) 10 ug
$750.00
MR216001L4 Lenti ORF clone of Emp2 (mGFP-tagged) - Mouse epithelial membrane protein 2 (Emp2) 10 ug
$750.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.