H2aj (NM_177688) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG215744
H2afj (tGFP-tagged) - Mouse H2A histone family member J (H2afj), (10ug)
  $350.00
3 Weeks*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol H2aj
Synonyms E130307C13; H2af; H2afj
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG215744 representing NM_177688
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCGGGCGAGGCAAGCAGGGCGGTAAGGTGCGCGCCAAGGCCAAGTCGCGCTCGTCGCGCGCGGGCC
TGCAGTTCCCCGTGGGCCGCGTTCACCGGCTGCTGCGGAAGGGCAACTACGCGGAGCGCGTGGGCGCGGG
AGCGCCCGTGTACCTGGCGGCGGTGCTGGAGTACCTGACGGCCGAGATCCTGGAGCTGGCGGGCAACGCG
GCGAGGGACAACAAGAAGACGCGCATCATCCCTCGTCACCTGCAGCTGGCCATCCGCAACGACGAGGAGC
TCAACAAGCTGCTGGGCCGTGTGACCATCGCGCAGGGCGGCGTCCTGCCCAATATCCAGGCCGTGCTGCT
GCCCAAGAAGACGGAGAGCCAGAAGGTGAAGAGCAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG215744 representing NM_177688
Red=Cloning site Green=Tags(s)

MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNA
ARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESQKVKSK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_177688
ORF Size 387 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_177688.4, NP_808356.1
RefSeq Size 1827 bp
RefSeq ORF 390 bp
Locus ID 232440
UniProt ID Q8R1M2
Cytogenetics 6 G1
Summary Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is located on chromosome 6 and encodes a replication-independent histone that is member of the histone H2A family. provided by RefSeq, Nov 2015
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_177688" in other vectors (4)
SKU Description Size Price
MC201804 H2afj (untagged) - Mouse H2A histone family, member J (H2afj), (10ug) 10 ug
$150.00
MR215744 H2afj (Myc-DDK-tagged) - Mouse H2A histone family, member J (H2afj) 10 ug
$289.00
MR215744L3 Lenti ORF clone of H2afj (Myc-DDK-tagged) - Mouse H2A histone family, member J (H2afj) 10 ug
$450.00
MR215744L4 Lenti ORF clone of H2afj (mGFP-tagged) - Mouse H2A histone family, member J (H2afj) 10 ug
$450.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.