Fabp6 (NM_008375) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG215685
Fabp6 (tGFP-tagged) - Mouse fatty acid binding protein 6 ileal (gastrotropin) (Fabp6), (10ug)
  $350.00
3 Weeks*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Fabp6
Synonyms GT; I; I-1; I-15P; I-B; I-BABP; IL; ILBP; ILBP3; Illbp
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG215685 representing NM_008375
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTTCAGTGGCAAATATGAATTTGAGAGTGAGAAGAATTACGATGAGTTCATGAAGCGCCTGGGTC
TTCCAGGAGACGTGATTGAAAGGGGACGTAACTTCAAGATCATCACAGAGGTCCAGCAGGACGGACAGGA
CTTCACCTGGTCCCAGTCTTACTCTGGGGGCAACATTATGAGCAACAAGTTCACCATTGGCAAAGAATGT
GAAATGCAGACCATGGGGGGCAAGAAGTTCAAGGCTACCGTGAAGATGGAGGGTGGCAAGGTGGTGGCAG
AGTTCCCCAACTATCACCAGACTTCGGAGGTCGTGGGTGACAAGTTGGTGGAGATCTCCACCATCGGGGA
TGTGACCTATGAGCGCGTAAGCAAGAGGCTGGCT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG215685 representing NM_008375
Red=Cloning site Green=Tags(s)

MAFSGKYEFESEKNYDEFMKRLGLPGDVIERGRNFKIITEVQQDGQDFTWSQSYSGGNIMSNKFTIGKEC
EMQTMGGKKFKATVKMEGGKVVAEFPNYHQTSEVVGDKLVEISTIGDVTYERVSKRLA

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_008375
ORF Size 384 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_008375.2, NP_032401.1
RefSeq Size 387 bp
RefSeq ORF 387 bp
Locus ID 16204
UniProt ID P51162
Cytogenetics 11 25.81 cM
Summary The protein encoded by this gene is part of the fatty acid binding protein family (FABP). FABPs are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands and participate in fatty acid uptake, transport, and metabolism. This protein functions within the ileum, the distal 25-30% of the small intestine, and plays a role in enterohepatic circulation of bile acids and cholesterol homeostasis. In humans, it has been reported that polymorphisms in FABP6 confer a protective effect in obese individuals from developing type 2 diabetes. In mice deficiency of this gene affects bile acid metabolism in a gender-specific manner and was reported to be required for efficient apical to basolateral transport of conjugated bile acids. provided by RefSeq, Jan 2013
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_008375" in other vectors (4)
SKU Description Size Price
MC208789 Fabp6 (untagged) - Mouse fatty acid binding protein 6, ileal (gastrotropin) (Fabp6), (10ug) 10 ug
$165.00
MR215685 Fabp6 (Myc-DDK-tagged) - Mouse fatty acid binding protein 6, ileal (gastrotropin) (Fabp6) 10 ug
$289.00
MR215685L3 Lenti ORF clone of Fabp6 (Myc-DDK-tagged) - Mouse fatty acid binding protein 6, ileal (gastrotropin) (Fabp6) 10 ug
$450.00
MR215685L4 Lenti ORF clone of Fabp6 (mGFP-tagged) - Mouse fatty acid binding protein 6, ileal (gastrotropin) (Fabp6) 10 ug
$450.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.