Sprr2d (NM_011470) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG215356
Sprr2d (tGFP-tagged) - Mouse small proline-rich protein 2D (Sprr2d), (10ug)
  $350.00
3 Weeks*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Sprr2d
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG215356 representing NM_011470
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTTACCAGCAGCAGCAGTGCAAGCAGCCTTGCCAGCCTCCACCTGTGTGCCCACCCAAGAAGTGCC
CTGAGCCTTGTCCTCCTCTAAAGTGTCCTGAGCCTTGTCCTCCACCAAAGTGCCCTGAGCCTTGTCCTCC
TCCAAAATGCCCAGAGCCTTGTCCTGAGCCATGTCCCCCTCCCTCATGCCAGCAGAAATGCCCTCCTGCG
CAACCTCCTCCACCCTGCCAGCAGAAGTGCCCACCTAAGAGCAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG215356 representing NM_011470
Red=Cloning site Green=Tags(s)

MSYQQQQCKQPCQPPPVCPPKKCPEPCPPLKCPEPCPPPKCPEPCPPPKCPEPCPEPCPPPSCQQKCPPA
QPPPPCQQKCPPKSK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_011470
ORF Size 255 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_011470.2, NP_035600.1
RefSeq Size 681 bp
RefSeq ORF 258 bp
Locus ID 20758
UniProt ID O70555
Cytogenetics 3 40.14 cM
Summary Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane (By similarity).UniProtKB/Swiss-Prot Function
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_011470" in other vectors (4)
SKU Description Size Price
MC209456 Sprr2d (untagged) - Mouse small proline-rich protein 2D (Sprr2d), (10ug) 10 ug
$165.00
MR215356 Sprr2d (Myc-DDK-tagged) - Mouse small proline-rich protein 2D (Sprr2d) 10 ug
$289.00
MR215356L3 Lenti ORF clone of Sprr2d (Myc-DDK-tagged) - Mouse small proline-rich protein 2D (Sprr2d) 10 ug
$450.00
MR215356L4 Lenti ORF clone of Sprr2d (mGFP-tagged) - Mouse small proline-rich protein 2D (Sprr2d) 10 ug
$450.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.