OriGene Logo

Apoo (NM_026673) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG215194
Apoo (tGFP-tagged) - Mouse apolipoprotein O (Apoo), (10ug)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $500.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Apoo or NM_026673"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Apoo
Synonyms 0610008C08Rik; 1110019O03Rik
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG215194 representing NM_026673
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTCAAGGTAATTCAGAGATCTGTGGGGCCAGCCAGCCTGAGCCTGCTCACCTTCAGAGTCTATGCAG
CACCCAAAAAGGACTCGCCTCACAAAAGTTACATGAAGATCGATGAGCTTTCACTCTACTCAGTTCCTGA
GGGTCAATCTAAATATGTGGAGGAGCCAAGGACTCAACTTGAAGAAAACATCTCACAACTCCGACATCAT
TGTGAGCCATATACAAGTTTCTGTCAGGAAATATACTCCCATACTAAACCCAAGGTGGATCACTTTGTCC
AGTGGGGAGTAGACAACTATAACTATCTTCAAAATGCGCCTCCTGGATTTTTCCCAAGACTCGGTGTTAT
TGGTTTTGCTGGTTTTGTTGGACTCCTTTTTGCTAGAGGTTCAAAAATAAAGAAGCTGGTGTATCCTCCT
TTTTTCATGGGATTAGGTGCCTCTGTCTATTACCCACAACAAGCCATCACCATTGCCCAGATCACTGGGG
AGAAGTTATATGACTGGGGATTACGAGGGTACATAGTTATAGAAGATTTGTGGAAGCAAAATTTTCAGAA
GCCAGGAAATGTGAAGAATTCACCTGGAAATAAA

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG215194 representing NM_026673
Red=Cloning site Green=Tags(s)

MFKVIQRSVGPASLSLLTFRVYAAPKKDSPHKSYMKIDELSLYSVPEGQSKYVEEPRTQLEENISQLRHH
CEPYTSFCQEIYSHTKPKVDHFVQWGVDNYNYLQNAPPGFFPRLGVIGFAGFVGLLFARGSKIKKLVYPP
FFMGLGASVYYPQQAITIAQITGEKLYDWGLRGYIVIEDLWKQNFQKPGNVKNSPGNK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_026673
ORF Size 594 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_026673.4, NP_080949.2
RefSeq Size 920 bp
RefSeq ORF 597 bp
Locus ID 68316
UniProt ID Q9DCZ4
Cytogenetics X C3
Summary Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. Plays a crucial role in crista junction formation and mitochondrial function (By similarity). Can induce cardiac lipotoxicity by enhancing mitochondrial respiration and fatty acid metabolism in cardiac myoblasts (PubMed:24743151). Promotes cholesterol efflux from macrophage cells. Detected in HDL, LDL and VLDL. Secreted by a microsomal triglyceride transfer protein (MTTP)-dependent mechanism, probably as a VLDL-associated protein that is subsequently transferred to HDL (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_026673" in other vectors (4)
SKU Description Size Price
MC210715 Apoo (untagged) - Mouse apolipoprotein O (Apoo), transcript variant 1, (10ug) 10 ug
$330.00
MR215194 Apoo (Myc-DDK-tagged) - Mouse apolipoprotein O (Apoo), transcript variant 1 10 ug
$289.00 $300.00
MR215194L3 Lenti ORF clone of Apoo (Myc-DDK-tagged) - Mouse apolipoprotein O (Apoo), transcript variant 1 10 ug
$600.00
MR215194L4 Lenti ORF clone of Apoo (mGFP-tagged) - Mouse apolipoprotein O (Apoo), transcript variant 1 10 ug
$600.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.