OriGene Logo

Cops9 (NM_001163425) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG214557
Myeov2 (tGFP-tagged) - Mouse myeloma overexpressed 2 (Myeov2) transcript variant 1, (10ug)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $350.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Cops9 or NM_001163425"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Cops9
Synonyms 1110002M09Rik; Myeov2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG214557 representing NM_001163425
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAACCCGCAGTGGATGAGATGTTCCCCGAGGGCGCGGGGCCCTATGTGGACCTGGATGAGGCTGGAG
GTAGCACCGGGCTTTTGATGGACCTGGCAGCCAATGAGAAGGCCGTTCATGCAGACTTTTTTAATGATTT
TGAAGACCTTTTTGATGATGATGATGTCCAG

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG214557 representing NM_001163425
Red=Cloning site Green=Tags(s)

MKPAVDEMFPEGAGPYVDLDEAGGSTGLLMDLAANEKAVHADFFNDFEDLFDDDDVQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001163425
ORF Size 171 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001163425.1, NP_001156897.1
RefSeq Size 458 bp
RefSeq ORF 174 bp
Locus ID 66915
UniProt ID Q3U898
Cytogenetics 1 D
Summary Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. Plays a role in cell proliferation.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_001163425" in other vectors (4)
SKU Description Size Price
MC210454 Myeov2 (untagged) - Mouse myeloma overexpressed 2 (Myeov2), transcript variant 1, (10ug) 10 ug
$165.00
MR214557 Myeov2 (Myc-DDK-tagged) - Mouse myeloma overexpressed 2 (Myeov2), transcript variant 1 10 ug
$289.00
MR214557L3 Lenti ORF clone of Myeov2 (Myc-DDK-tagged) - Mouse myeloma overexpressed 2 (Myeov2), transcript variant 1 10 ug
$450.00
MR214557L4 Lenti ORF clone of Myeov2 (mGFP-tagged) - Mouse myeloma overexpressed 2 (Myeov2), transcript variant 1 10 ug
$450.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.