OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Slbp (BC029631) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG203271
Slbp (tGFP-tagged) - Mouse stem-loop binding protein (cDNA clone MGC:5912 IMAGE:3500676)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $500.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Slbp or BC029631"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Slbp
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG203271 representing BC029631
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTGCAGACCTAGAAGCCCACCCGGTTATGGGAGTCGCCGCGACGGTGGTGCGAGCCCGCGGTCCC
CTGCGAGATGGAGTCTCGGACGGAAGCGCAGAGCGGACGGAAGGGACCGGAAGCCCGAGGACTCCGAGGA
AGGCGAGCTCCAGACTGCGGACCACCGACCTGAAAGCTTTACAACTCCTGAAGGCCATAAGCCCCGTTCT
AGATGTTCTGACTGGGCCAGTGCAGTTGAAGAAGATGAAATGAGGACCAGAGTTAACAAAGAGATTGCAA
GTTCTGATTCAAAGGAGTCTATGTCTTCAGTGCCTGCTGATGTGGAGACGGATGAAAGTGTCTTGATGAG
AAGGCAGAAGCAGATCAACTACGGGAAGAACACTATTGCCTATGATCGATATATTAAAGAGGTGCCCAGA
CACCTGCGACAACCTGGAATCCATCCCAGGACCCCCAACAAATTTAAGAAGTACAGCCGGCGGTCATGGG
ACCAACAAATTAAACTCTGGAAGGTGGCTTTGCATTTTTGGGATCCTCCTGCTGAAGAAGGATGTGATTT
GCAAGAAATACAACCTGTAGATCTTGGGGAAATGGAGACTGAATTCACAGAAAGCAGCTCTGAGTCTCAG
ACAAGTTCACAGGATAACTTTGATGTGTATGCTGGCACACCCACCAAAGTCAGACACGTGGACTGCCAAG
TGGAGGATGAGTTTGATTTGGAAGCTTGTTTAACTGAACCTTTGAAAGACTTCTCTGCCATGAGT

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG203271 representing BC029631
Red=Cloning site Green=Tags(s)

MACRPRSPPGYGSRRDGGASPRSPARWSLGRKRRADGRDRKPEDSEEGELQTADHRPESFTTPEGHKPRS
RCSDWASAVEEDEMRTRVNKEIASSDSKESMSSVPADVETDESVLMRRQKQINYGKNTIAYDRYIKEVPR
HLRQPGIHPRTPNKFKKYSRRSWDQQIKLWKVALHFWDPPAEEGCDLQEIQPVDLGEMETEFTESSSESQ
TSSQDNFDVYAGTPTKVRHVDCQVEDEFDLEACLTEPLKDFSAMS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN BC029631
ORF Size 765 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq BC029631, AAH29631
RefSeq Size 1595 bp
RefSeq ORF 767 bp
Locus ID 20492
Cytogenetics 5 B2
Summary RNA-binding protein involved in the histone pre-mRNA processing. Binds the stem-loop structure of replication-dependent histone pre-mRNAs and contributes to efficient 3'-end processing by stabilizing the complex between histone pre-mRNA and U7 small nuclear ribonucleoprotein (snRNP), via the histone downstream element (HDE). Plays an important role in targeting mature histone mRNA from the nucleus to the cytoplasm and to the translation machinery. Stabilizes mature histone mRNA and could be involved in cell-cycle regulation of histone gene expression (By similarity). Involved in the mechanism by which growing oocytes accumulate histone proteins that support early embryogenesis. Binds to the 5' side of the stem-loop structure of histone pre-mRNAs.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"BC029631" in other vectors (4)
SKU Description Size Price
MC217747 Slbp (untagged) - Mouse stem-loop binding protein (cDNA clone MGC:5912 IMAGE:3500676), (10ug) 10 ug
$330.00
MR203271 Slbp (Myc-DDK-tagged) - Mouse stem-loop binding protein (cDNA clone MGC:5912 IMAGE:3500676) 10 ug
$289.00 $300.00
MR203271L3 Lenti ORF clone of Slbp (Myc-DDK-tagged) - Mouse stem-loop binding protein (cDNA clone MGC:5912 IMAGE:3500676) 10 ug
$600.00
MR203271L4 Lenti ORF clone of Slbp (mGFP-tagged) - Mouse stem-loop binding protein (cDNA clone MGC:5912 IMAGE:3500676) 10 ug
$600.00

Plasmid Map for MG203271

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MG203271
Circular map for MG203271

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products