Chmp4b (BC011429) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG202622
Chmp4b (tGFP-tagged) - Mouse chromatin modifying protein 4B (cDNA clone MGC:19416 IMAGE:3485793)
  $500.00
3 Weeks*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Chmp4b
Synonyms 2010012F05Rik; C76846; Snf7-2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG202622 representing BC011429
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGTGTTCGGGAAGCTGTTCGGGGCTGGAGGGGGTAAGGCGGGCAAGGGCGGCCCGACCCCCCAGG
AGGCCATCCAGCGGCTTCGGGACACGGAGGAGATGTTAAGCAAGAAGCAGGAGTTCCTGGAGAAGAAAAT
CGAACAGGAGCTGACGGCTGCCAAGAAGCACGGCACCAAAAATAAGCGCGCCGCCCTGCAGGCTCTGAAG
CGCAAGAAGAGGTATGAGAAGCAGCTGGCACAAATTGATGGCACCCTGTCAACCATCGAGTTCCAGCGGG
AGGCCCTAGAGAACGCCAACACCAACACGGAGGTGCTCAAGAACATGGGCTATGCCGCCAAGGCCATGAA
GGCTGCCCACGACAACATGGACATTGATAAGGTGGATGAGTTAATGCAGGACATTGCTGACCAGCAAGAA
CTTGCAGAGGAGATTTCCACAGCTATCTCCAAACCTGTGGGCTTTGGAGAAGAGTTCGACGAGGATGAGC
TCATGGCAGAGTTGGAGGAACTTGAACAAGAGGAGTTGGACAAGAATTTGTTGGAGATCAGTGGGCCCGA
AACAGTCCCTCTACCAAATGTCCCCTCCGTAGCCCTACCATCCAAACCCGCCAAGAAGAAGGAAGAGGAA
GATGACGACATGAAGGAATTGGAGAACTGGGCCGGATCCATG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG202622 representing BC011429
Red=Cloning site Green=Tags(s)

MSVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKKQEFLEKKIEQELTAAKKHGTKNKRAALQALK
RKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAHDNMDIDKVDELMQDIADQQE
LAEEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNLLEISGPETVPLPNVPSVALPSKPAKKKEEE
DDDMKELENWAGSM

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN BC011429
ORF Size 672 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq BC011429, AAH11429
RefSeq Size 1080 bp
RefSeq ORF 674 bp
Locus ID 75608
Cytogenetics 2 H1
Summary Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis. Together with SPAST, the ESCRT-III complex promotes nuclear envelope sealing and mitotic spindle disassembly during late anaphase. Plays a role in the endosomal sorting pathway. ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. When overexpressed, membrane-assembled circular arrays of CHMP4B filaments can promote or stabilize negative curvature and outward budding. CHMP4A/B/C are required for the exosomal release of SDCBP, CD63 and syndecan.UniProtKB/Swiss-Prot Function
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"BC011429" in other vectors (4)
SKU Description Size Price
MC200873 Chmp4b (untagged) - Mouse chromatin modifying protein 4B (cDNA clone MGC:19416 IMAGE:3485793), (10ug) 10 ug
$300.00
MR202622 Chmp4b (Myc-DDK-tagged) - Mouse chromatin modifying protein 4B (cDNA clone MGC:19416 IMAGE:3485793) 10 ug
$289.00 $300.00
MR202622L3 Lenti ORF clone of Chmp4b (Myc-DDK-tagged) - Mouse chromatin modifying protein 4B (cDNA clone MGC:19416 IMAGE:3485793) 10 ug
$600.00
MR202622L4 Lenti ORF clone of Chmp4b (mGFP-tagged) - Mouse chromatin modifying protein 4B (cDNA clone MGC:19416 IMAGE:3485793) 10 ug
$600.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.