OriGene Logo

Prrx1 (NM_175686) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG202408
Prrx1 (tGFP-tagged) - Mouse paired related homeobox 1 (Prrx1), transcript variant 2
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
  $650.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA363126 PRRX1 Antibody - middle region
100 ul
$585.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Prrx1 or NM_175686"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Prrx1
Synonyms A230024N07Rik; AA755424; AI385634; AI843499; K-2; mHox; Pmx; Pmx1; Prx1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG202408 representing NM_175686
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCTCCAGCTACGGGCACGTTCTGGAGCGGCAACCGGCGCTGGGCGGCCGCTTGGACAGCCCGGGCA
ACCTCGACACCCTGCAGGCGAAAAAGAACTTCTCCGTCAGTCACCTGCTAGACCTGGAGGAGGCCGGGGA
CATGGTGGCGGCACAAGCAGACGAAAGTGTGGGCGAGGCGGGCCGGAGCCTGCTGGAGTCACCGGGACTG
ACCAGTGGCAGCGACACCCCTCAGCAGGACAATGACCAGTTGAACTCTGAGGAGAAGAAGAAGAGAAAGC
AGCGGAGAAACAGGACAACATTCAACAGCAGCCAACTGCAGGCCTTGGAGCGTGTCTTTGAGCGGACACA
TTACCCGGATGCTTTTGTTCGAGAAGATCTCGCACGTCGGGTGAACCTCACTGAGGCCAGAGTGCAGGTG
TGGTTTCAGAACCGAAGAGCCAAGTTCCGCAGGAATGAGCGAGCCATGCTGGCCAATAAAAACGCTTCTC
TCCTCAAGTCCTACTCAGGAGACGTGACTGCTGTGGAGCAACCCATCGTACCTCGTCCTGCTCCCAGACC
AACCGATTATCTCTCCTGGGGGACAGCCTCTCCGTACAGATCTTCGTCCCTCCCAAGATGTTGTTTACAC
GAGGGGCTTCATAACGGATTC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG202408 representing NM_175686
Red=Cloning site Green=Tags(s)

MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADESVGEAGRSLLESPGL
TSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRVNLTEARVQV
WFQNRRAKFRRNERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYRSSSLPRCCLH
EGLHNGF

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_175686
ORF Size 651 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_175686.3, NP_783617.2
RefSeq Size 4983 bp
RefSeq ORF 654 bp
Locus ID 18933
UniProt ID P63013
Cytogenetics 1 70.53 cM
Summary Acts as a transcriptional regulator of muscle creatine kinase (MCK) and so has a role in the establishment of diverse mesodermal muscle types. The protein binds to an A/T-rich element in the muscle creatine enhancer.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_175686" in other vectors (4)
SKU Description Size Price
MC207352 Prrx1 (untagged) - Mouse paired related homeobox 1 (Prrx1), transcript variant 2, (10ug) 10 ug
$450.00
MR202408 Prrx1 (Myc-DDK-tagged) - Mouse paired related homeobox 1 (Prrx1), transcript variant 2 10 ug
$450.00
MR202408L3 Lenti ORF clone of Prrx1 (Myc-DDK-tagged) - Mouse paired related homeobox 1 (Prrx1), transcript variant 2 10 ug
$750.00
MR202408L4 Lenti ORF clone of Prrx1 (mGFP-tagged) - Mouse paired related homeobox 1 (Prrx1), transcript variant 2 10 ug
$750.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.