OriGene Logo

Mad2l2 (NM_027985) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG202284
Mad2l2 (tGFP-tagged) - Mouse MAD2 mitotic arrest deficient-like 2 (yeast) (Mad2l2)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $500.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Mad2l2 or NM_027985"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Mad2l2
Synonyms 2310033C13Rik; G1-453-4; MAD2B; repro22; REV7
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG202284 representing NM_027985
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCACCCTCACGCGCCAAGACCTCAACTTTGGCCAAGTGGTGGCTGACGTGCTCTCCGAGTTCCTGG
AGGTGGCCGTGCACCTGATTCTCTATGTGCGCGAGGTCTACCCGGTGGGCATCTTCCAGAAGCGCAAGAA
GTACAACGTGCCGGTTCAGATGTCCTGTCATCCGGAGCTGAACCAGTACATCCAGGACACACTCCACTGC
GTCAAACCTCTCCTGGAGAAGAACGATGTGGAGAAGGTGGTGGTGGTGATTTTGGATAAGGAACACCGCC
CAGTGGAGAAGTTTGTCTTTGAGATCACTCAGCCTCCCTTGCTGTCCATCAATTCAGACTCCCTCCTGTC
TCATGTGGAGCAGCTGCTTCGAGCCTTCATCCTTAAGATTAGTGTGTGTGATGCTGTCCTGGATCACAAC
CCTCCAGGCTGCACATTTACAGTCCTCGTGCACACAAGAGAAGCTGCTACTCGAAACATGGAGAAGATAC
AGGTCATCAAGGACTTCCCATGGATCCTGGCAGATGAACAGGATGTCCACATGCACGACCCCCGCTTGAT
ACCCCTAAAAACCATGACGTCGGACATTTTAAAGATGCAGCTCTACGTTGAAGAGCGAGCGCATAAGAAC
AGC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG202284 representing NM_027985
Red=Cloning site Green=Tags(s)

MTTLTRQDLNFGQVVADVLSEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHC
VKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSINSDSLLSHVEQLLRAFILKISVCDAVLDHN
PPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKN
S

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_027985
ORF Size 633 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_027985.2, NP_082261.2
RefSeq Size 1224 bp
RefSeq ORF 636 bp
Locus ID 71890
UniProt ID Q9D752
Cytogenetics 4 E2
Summary Adapter protein able to interact with different proteins and involved in different biological processes. Mediates the interaction between the error-prone DNA polymerase zeta catalytic subunit REV3L and the inserter polymerase REV1, thereby mediating the second polymerase switching in translesion DNA synthesis. Translesion DNA synthesis releases the replication blockade of replicative polymerases, stalled in presence of DNA lesions. Component of the shieldin complex, which plays an important role in repair of DNA double-stranded breaks (DSBs). During G1 and S phase of the cell cycle, the complex functions downstream of TP53BP1 to promote non-homologous end joining (NHEJ) and suppress DNA end resection. Mediates various NHEJ-dependent processes including immunoglobulin class-switch recombination, and fusion of unprotected telomeres. May also regulate another aspect of cellular response to DNA damage through regulation of the JNK-mediated phosphorylation and activation of the transcriptional activator ELK1. Inhibits the FZR1- and probably CDC20-mediated activation of the anaphase promoting complex APC thereby regulating progression through the cell cycle. Regulates TCF7L2-mediated gene transcription and may play a role in epithelial-mesenchymal transdifferentiation.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_027985" in other vectors (4)
SKU Description Size Price
MC200866 Mad2l2 (untagged) - Mouse MAD2 mitotic arrest deficient-like 2 (yeast) (Mad2l2), (10ug) 10 ug
$300.00
MR202284 Mad2l2 (Myc-DDK-tagged) - Mouse MAD2 mitotic arrest deficient-like 2 (yeast) (Mad2l2) 10 ug
$289.00 $300.00
MR202284L3 Lenti ORF clone of Mad2l2 (Myc-DDK-tagged) - Mouse MAD2 mitotic arrest deficient-like 2 (yeast) (Mad2l2) 10 ug
$600.00
MR202284L4 Lenti ORF clone of Mad2l2 (mGFP-tagged) - Mouse MAD2 mitotic arrest deficient-like 2 (yeast) (Mad2l2) 10 ug
$600.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.