Rnf138 (NM_019706) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG202240
Rnf138 (tGFP-tagged) - Mouse ring finger protein 138 (Rnf138), transcript variant 2
  $500.00
3 Weeks*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Rnf138
Synonyms 2410015A17Rik; 2810480D20Rik; STRIN; Trif; Trif-d
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG202240 representing NM_019706
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCGAGGAACTTTCGGCGGCCACGTCCTACACGGAAGATGATTTCTACTGCCCTGTCTGTCAGGAGG
TGCTCAAGACGCCGGTGCGGACCGCGGCCTGTCAGCACGTTTTCTGTAGAAAATGTTTCCTGACTGCAAT
GAGAGAAAGTGGAATACATTGTCCCCTATGTCGTGGAAGTGTGACTAGAAGAGAAAGAGCATGTCCGGAA
CGGGCCTTAGATCTTGAAAATATCATGAGGAGGTTTTCTGGTAGCTGCAGATGCTGTTCAAAAAAGATTA
AATTCTATCGCATGAGACATCATTACAAATCTTGTAAGAAGTATCAGGATGAATATGGTGTTTCTTCTGT
CATTCCAAACTTTAAGATTTCTCAAGATTCAGTAAGGAGCAGTAATAGGAGTGAAACATCTGCATCTGAT
AACACAGAAACTTATCAAGAGGATACAAGTTCTTCTGGGCATCCTACCTTTAAGTGTCCCTTATGTCAAG
AGTCAAATTTCACCAGACAACGTTTATTGGATCACTGTAATAGTAACCACCTATTTCAGATAGTTCCTGT
GAATCTTCAGCTAGATGAGGAAACCCAATATCAAACTGCTGTGGAAGAGTCTTTTCAAGTAAACATG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG202240 representing NM_019706
Red=Cloning site Green=Tags(s)

MSEELSAATSYTEDDFYCPVCQEVLKTPVRTAACQHVFCRKCFLTAMRESGIHCPLCRGSVTRRERACPE
RALDLENIMRRFSGSCRCCSKKIKFYRMRHHYKSCKKYQDEYGVSSVIPNFKISQDSVRSSNRSETSASD
NTETYQEDTSSSGHPTFKCPLCQESNFTRQRLLDHCNSNHLFQIVPVNLQLDEETQYQTAVEESFQVNM

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_019706
ORF Size 627 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_019706.3, NP_062680.2
RefSeq Size 3002 bp
RefSeq ORF 630 bp
Locus ID 56515
UniProt ID Q9CQE0
Cytogenetics 18 A2
Summary E3 ubiquitin-protein ligase involved in DNA damage response by promoting DNA resection and homologous recombination. Recruited to sites of double-strand breaks following DNA damage and specifically promotes double-strand break repair via homologous recombination. Two different, non-exclusive, mechanisms have been proposed. According to a report, regulates the choice of double-strand break repair by favoring homologous recombination over non-homologous end joining (NHEJ): acts by mediating ubiquitination of XRCC5/Ku80, leading to remove the Ku complex from DNA breaks, thereby promoting homologous recombination. According to another report, cooperates with UBE2Ds E2 ubiquitin ligases (UBE2D1, UBE2D2, UBE2D3 or UBE2D4) to promote homologous recombination by mediating ubiquitination of RBBP8/CtIP. Together with NLK, involved in the ubiquitination and degradation of TCF/LEF. Also exhibits auto-ubiquitination activity in combination with UBE2K. May act as a negative regulator in the Wnt/beta-catenin-mediated signaling pathway.UniProtKB/Swiss-Prot Function
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_019706" in other vectors (4)
SKU Description Size Price
MC210067 Rnf138 (untagged) - Mouse ring finger protein 138 (Rnf138), transcript variant 2, (10ug) 10 ug
$330.00
MR202240 Rnf138 (Myc-DDK-tagged) - Mouse ring finger protein 138 (Rnf138), transcript variant 2 10 ug
$289.00 $300.00
MR202240L3 Lenti ORF clone of Rnf138 (Myc-DDK-tagged) - Mouse ring finger protein 138 (Rnf138), transcript variant 2 10 ug
$600.00
MR202240L4 Lenti ORF clone of Rnf138 (mGFP-tagged) - Mouse ring finger protein 138 (Rnf138), transcript variant 2 10 ug
$600.00

Welcome to OriGene AI!

I'm your AI-powered guide to everything OriGene.
Ask me anything:

  • Product specs
  • Ordering help
  • Technical questions
  • How to find exactly what your experiment needs

Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.

Velaro Chat Img

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.