OriGene Logo

Ranbp1 (NM_011239) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG202097
Ranbp1 (tGFP-tagged) - Mouse RAN binding protein 1 (Ranbp1)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $500.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Ranbp1 or NM_011239"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Ranbp1
Synonyms Htf9a
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG202097 representing NM_011239
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCCGCCAAGGACAGTCACGAGGACCATGATACTTCCACAGAGAATGCAGATGAGTCCAACCACG
ACCCCCAGTTCGAGCCAATAGTTTCTCTTCCCGAGCAAGAAATTAAAACGCTGGAGGAAGATGAAGAGGA
ACTTTTTAAGATGCGTGCAAAGCTGTTCCGGTTTGCTTCAGAGAATGACCTCCCAGAATGGAAGGAGCGA
GGCACTGGAGATGTCAAGCTTCTGAAGCACAAGGAGAAAGGGACCATCCGCCTTCTTATGAGGAGGGACA
AAACCTTGAAGATATGCGCCAACCACTATATTACACCAATGATGGAGCTGAAGCCGAATGCTGGCAGTGA
CCGAGCCTGGGTCTGGAATACCCACGCCGACTTTGCTGACGAGTGCCCCAAGCCTGAGCTGCTCGCCATC
CGCTTCCTAAATGCTGAGAATGCACAAAAGTTCAAAACAAAGTTTGAAGAATGCAGGAAAGAAATTGAAG
AGAGAGAAAAGAAAGGACCAGGCAAAAATGATAATGCCGAAAAGGTGGCCGAGAAGCTGGAAGCCCTTTC
AGTGAGGGAGGCCAGAGAGGAGGCTGAAGAGAAGTCTGAGGAGAAACAA

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG202097 representing NM_011239
Red=Cloning site Green=Tags(s)

MAAAKDSHEDHDTSTENADESNHDPQFEPIVSLPEQEIKTLEEDEEELFKMRAKLFRFASENDLPEWKER
GTGDVKLLKHKEKGTIRLLMRRDKTLKICANHYITPMMELKPNAGSDRAWVWNTHADFADECPKPELLAI
RFLNAENAQKFKTKFEECRKEIEEREKKGPGKNDNAEKVAEKLEALSVREAREEAEEKSEEKQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_011239
ORF Size 609 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_011239.2, NP_035369.2
RefSeq Size 852 bp
RefSeq ORF 612 bp
Locus ID 19385
UniProt ID P34022
Cytogenetics 16 11.3 cM
Summary Plays a role in RAN-dependent nucleocytoplasmic transport. Alleviates the TNPO1-dependent inhibition of RAN GTPase activity and mediates the dissociation of RAN from proteins involved in transport into the nucleus (PubMed:9428644). Induces a conformation change in the complex formed by XPO1 and RAN that triggers the release of the nuclear export signal of cargo proteins (By similarity). Promotes the disassembly of the complex formed by RAN and importin beta. Promotes dissociation of RAN from a complex with KPNA2 and CSE1L (PubMed:9428644). Required for normal mitotic spindle assembly and normal progress through mitosis via its effect on RAN (By similarity). Does not increase the RAN GTPase activity by itself, but increases GTP hydrolysis mediated by RANGAP1 (PubMed:9428644). Inhibits RCC1-dependent exchange of RAN-bound GDP by GTP (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_011239" in other vectors (4)
SKU Description Size Price
MC209292 Ranbp1 (untagged) - Mouse RAN binding protein 1 (Ranbp1), (10ug) 10 ug
$330.00
MR202097 Ranbp1 (Myc-DDK-tagged) - Mouse RAN binding protein 1 (Ranbp1) 10 ug
$289.00 $300.00
MR202097L3 Lenti ORF clone of Ranbp1 (Myc-DDK-tagged) - Mouse RAN binding protein 1 (Ranbp1) 10 ug
$600.00
MR202097L4 Lenti ORF clone of Ranbp1 (mGFP-tagged) - Mouse RAN binding protein 1 (Ranbp1) 10 ug
$600.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.