OriGene Logo

Rab10 (NM_016676) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG202024
Rab10 (tGFP-tagged) - Mouse RAB10, member RAS oncogene family (Rab10)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $500.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA329177 Rabbit Polyclonal anti-Rab10 antibody
100 ul
$585.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Rab10 or NM_016676"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Rab10
Synonyms AW107754
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG202024 representing NM_016676
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGAAGAAGACGTACGACCTGCTTTTCAAGCTGCTCCTGATCGGGGACTCGGGAGTGGGCAAGACCT
GCGTCCTTTTTCGTTTTTCGGACGATGCCTTCAATACCACCTTTATTTCCACCATAGGAATAGACTTTAA
GATCAAAACAGTGGAACTACAAGGAAAGAAGATCAAGCTACAGATATGGGACACAGCAGGCCAGGAGCGA
TTTCACACCATCACAACCTCCTACTACAGAGGAGCAATGGGCATCATGCTAGTGTATGACATCACCAACG
GTAAAAGCTTTGAGAACATCAGCAAGTGGCTTAGAAACATAGATGAGCATGCCAATGAAGATGTGGAAAG
AATGTTACTAGGGAACAAGTGTGACATGGACGACAAGAGAGTTGTACCGAAAGGCAAAGGAGAACAGATT
GCAAGGGAGCATGGTATTAGGTTTTTTGAGACTAGTGCAAAAGCAAATATAAACATCGAAAAGGCGTTCC
TCACATTAGCTGAAGACATCCTCCGAAAGACCCCTGTAAAAGAACCCAACAGTGAAAACGTAGATATCAG
CAGTGGAGGAGGCGTGACGGGCTGGAAGAGCAAGTGCTGC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG202024 representing NM_016676
Red=Cloning site Green=Tags(s)

MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQER
FHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQI
AREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_016676
ORF Size 600 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016676.5
RefSeq Size 3477 bp
RefSeq ORF 603 bp
Locus ID 19325
UniProt ID P61027
Cytogenetics 12 1.71 cM
Summary The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion (By similarity). That Rab is mainly involved in the biosynthetic transport of proteins from the Golgi to the plasma membrane. Regulates, for instance, SLC2A4/GLUT4 glucose transporter-enriched vesicles delivery to the plasma membrane. In parallel, it regulates the transport of TLR4, a toll-like receptor to the plasma membrane and therefore may be important for innate immune response. Plays also a specific role in asymmetric protein transport to the plasma membrane within the polarized neuron and epithelial cells. In neurons, it is involved in axonogenesis through regulation of vesicular membrane trafficking toward the axonal plasma membrane while in epithelial cells, it regulates transport from the Golgi to the basolateral membrane. Moreover, may play a role in the basolateral recycling pathway and in phagosome maturation. Finally, may play a role in endoplasmic reticulum dynamics and morphology controlling tubulation along microtubules and tubules fusion.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_016676" in other vectors (4)
SKU Description Size Price
MC205309 Rab10 (untagged) - Mouse RAB10, member RAS oncogene family (Rab10), (10ug) 10 ug
$300.00
MR202024 Rab10 (Myc-DDK-tagged) - Mouse RAB10, member RAS oncogene family (Rab10) 10 ug
$289.00 $300.00
MR202024L3 Lenti ORF clone of Rab10 (Myc-DDK-tagged) - Mouse RAB10, member RAS oncogene family (Rab10) 10 ug
$600.00
MR202024L4 Lenti ORF clone of Rab10 (mGFP-tagged) - Mouse RAB10, member RAS oncogene family (Rab10) 10 ug
$600.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.