OriGene Logo

Chmp1b (NM_024190) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG202011
Chmp1b (tGFP-tagged) - Mouse chromatin modifying protein 1B (Chmp1b)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $500.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Chmp1b or NM_024190"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Chmp1b
Synonyms 2810405I11Rik; Chmp1b1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG202011 representing NM_024190
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCAACATGGAGAAGCATCTGTTCAACCTGAAATTCGCGGCCAAAGAACTGAACCGGAGTTCCAAAA
AATGCGACAAGGAAGAAAAGGCCGAAAAGGCCAAAATTAAAAAGGCCATTCAGAAGGGCAACATGGAAGT
TGCGAGGATTCACGCCGAAAATGCCATCCGCCAGAAGAATCAAGGGGTGAACTTCTTGAGAATGAGTGCA
CGAGTGGATGCGGTGGCGGCCCGTGTCCAGACTGCAGTGACGATGGGCAAAGTGACCAAGTCCATGGCGG
GTGTGGTTAAGTCGATGGACGCGACGTTGAAAAGTATGAATCTGGAGAAGATCTCCGCTTTGATGGACAA
ATTCGAACACCAGTTCGAGACTCTGGACGTCCAGACGCAGCAAATGGAAGACACAATGAGCAGCACGACG
ACGCTGACCACTCCCCAGAACCAGGTGGATATGCTGCTCCAGGAAATGGCAGATGAGGCGGGCCTCGATC
TCAACATGGAGCTGCCTCAGGGCCAGACCGGTTCCGTGGGAACGAGCGTGGCTTCGGCTGAGCAAGATGA
ACTGTCCCAGAGACTGGCCCGCCTTCGGGATCAAGTC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG202011 representing NM_024190
Red=Cloning site Green=Tags(s)

MSNMEKHLFNLKFAAKELNRSSKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQGVNFLRMSA
RVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKSMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTT
TLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_024190
ORF Size 597 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_024190.2, NP_077152.1
RefSeq Size 1601 bp
RefSeq ORF 600 bp
Locus ID 67064
UniProt ID Q99LU0
Cytogenetics 18 E1
Summary Probable peripherally associated component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis. ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. Involved in cytokinesis. Involved in recruiting VPS4A and/or VPS4B and SPAST to the midbody of dividing cells (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_024190" in other vectors (4)
SKU Description Size Price
MC207606 Chmp1b (untagged) - Mouse chromatin modifying protein 1B (Chmp1b), (10ug) 10 ug
$330.00
MR202011 Chmp1b (Myc-DDK-tagged) - Mouse chromatin modifying protein 1B (Chmp1b) 10 ug
$289.00 $300.00
MR202011L3 Lenti ORF clone of Chmp1b (Myc-DDK-tagged) - Mouse chromatin modifying protein 1B (Chmp1b) 10 ug
$600.00
MR202011L4 Lenti ORF clone of Chmp1b (mGFP-tagged) - Mouse chromatin modifying protein 1B (Chmp1b) 10 ug
$600.00

Welcome to OriGene AI!

I'm your AI-powered guide to everything OriGene.
Ask me anything:

  • Product specs
  • Ordering help
  • Technical questions
  • How to find exactly what your experiment needs

Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.

Velaro Chat Img

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.