OriGene Logo

1500003O03Rik (BC054733) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG201918
1500003O03Rik (tGFP-tagged) - Mouse RIKEN cDNA 1500003O03 gene (cDNA clone MGC:64742 IMAGE:5720240)
Interest in protein/lysate? Submit request here!
  $500.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "1500003O03Rik or BC054733"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol 1500003O03Rik
Synonyms Sid470p, Chp, Cahp
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG201918 representing BC054733
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGTCTCGGGCCTCCACGTTATTGCGGGACGAAGAGCTCGAGGAGATCAAGAAGGAGACTGGCTTTT
CCCACAGTCAGATCACGCGCCTGTACAGCCGCTTCACCAGCCTGGACAAAGGGGAGAACGGGACTCTCAG
CCGGGAAGATTTCCAGAGGATTCCAGAACTTGCCATCAACCCACTGGGGGACCGGATCATCAATGCCTTC
TTCTCAGAGGGAGAGGATCAGGTAAACTTCCGAGGATTCATGAGAACATTGGCTCATTTCCGACCCATTG
AGGATAACGAAAAGAGCAAAGATGTGAATGGCCCGGAACCCCTCAACAGCCGGAGCAACAAGCTGCACTT
TGCTTTCAGACTCTATGATTTGGATAAAGATGACAAGATCTCCCGTGATGAGCTGTTACAGGTACTGCGA
ATGATGGTTGGAGTGAATATCTCGGATGAGCAGCTGGGCAGTATTGCGGACAGGACCATCCAGGAGGCTG
ACCAAGATGGAGATAGTGCCATATCTTTTACAGAATTCGTTAAGGTTTTGGAAAAAGTGGATGTAGAACA
GAAGATGAGCATCCGATTTCTTCAC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG201918 representing BC054733
Red=Cloning site Green=Tags(s)

MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAF
FSEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDDKISRDELLQVLR
MMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN BC054733
ORF Size 585 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq BC054733, AAH54733
RefSeq Size 2536 bp
RefSeq ORF 587 bp
Locus ID 56398
Cytogenetics 2 E5
Summary Calcium-binding protein involved in different processes such as regulation of vesicular trafficking, plasma membrane Na(+)/H(+) exchanger and gene transcription. Involved in the constitutive exocytic membrane traffic. Mediates the association between microtubules and membrane-bound organelles of the endoplasmic reticulum and Golgi apparatus and is also required for the targeting and fusion of transcytotic vesicles (TCV) with the plasma membrane. Functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na(+)/H(+) exchange activity. Affects the pH sensitivity of SLC9A1/NHE1 by increasing its sensitivity at acidic pH. Required for the stabilization and localization of SLC9A1/NHE1 at the plasma membranes. Inhibits serum- and GTPase-stimulated Na(+)/H(+) exchange. Plays a role as an inhibitor of ribosomal RNA transcription by repressing the nucleolar UBF1 transcriptional activity. May sequester UBF1 in the nucleoplasm and limit its translocation to the nucleolus. Associates to the ribosomal gene promoter. Acts as a negative regulator of the calcineurin/NFAT signaling pathway. Inhibits NFAT nuclear translocation and transcriptional activity by suppressing the calcium-dependent calcineurin phosphatase activity. Also negatively regulates the kinase activity of the apoptosis-induced kinase STK17B. Inhibits both STK17B auto- and substrate-phosphorylations in a calcium-dependent manner (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"BC054733" in other vectors (1)
SKU Description Size Price
MC206143 1500003O03Rik (untagged) - Mouse RIKEN cDNA 1500003O03 gene (cDNA clone MGC:64742 IMAGE:5720240), (10ug) 10 ug
$300.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.