OriGene Logo

Lat2 (NM_022964) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG201826
Lat2 (tGFP-tagged) - Mouse linker for activation of T cells family, member 2 (Lat2), transcript variant 2
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $500.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Lat2 or NM_022964"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Lat2
Synonyms AW125574; LAB; NTAL; Wbscr5; Wbscr15; WSCR5
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG201826 representing NM_022964
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTGCCGAGCTGGAGCTGCTGTGGCCGGTGTCGGGATTATTGCTGCTGCTGTTGGGGGCCACAGCCT
GGCTGTGTGTCCACTGCTCCCGTCCAGGAGTGAAGAGAAATGAGAAAATCTACGAGCAGAGGAACCGGCA
AGAAAATGCACAGAGCTCAGCTGCGGCTCAGACATACTCCCTGGCCAGGCAGGTGTGGCCAGGACCCCAG
ATGGACACAGCTCCAAACAAGTCATTTGAAAGGAAGAACAAGATGCTGTTCTCCCACCTTGAGGGAAGTA
ACCAGGAGCCTGATGCTGCCTATGTAGACCCCATCCCTACAAACTACTACAACTGGGGATGTTTCCAGAA
GCCCTCAGAAGACGACGATTCCAACTCCTACGAGAATGTGCTCGTCTGCAAGCCCAGCACCCCCGAGTCA
GGTGTCGAGGACTTTGAGGATTACCAGAACTCAGTATCCATCCATCAGTGGCGAGAGTCCAAGAGGACTA
TGGGTGCACCAATGTCCCTATCAGGAAGCCCAGATGAGGAGCCAGACTATGTGAATGGGGATGTGGCCGC
AGCAGAGAACATC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG201826 representing NM_022964
Red=Cloning site Green=Tags(s)

MSAELELLWPVSGLLLLLLGATAWLCVHCSRPGVKRNEKIYEQRNRQENAQSSAAAQTYSLARQVWPGPQ
MDTAPNKSFERKNKMLFSHLEGSNQEPDAAYVDPIPTNYYNWGCFQKPSEDDDSNSYENVLVCKPSTPES
GVEDFEDYQNSVSIHQWRESKRTMGAPMSLSGSPDEEPDYVNGDVAAAENI

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_022964
ORF Size 573 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_022964.4, NP_075253.2
RefSeq Size 1487 bp
RefSeq ORF 576 bp
Locus ID 56743
UniProt ID Q9JHL0
Cytogenetics 5 G2
Summary Involved in FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells. May also be involved in BCR (B-cell antigen receptor)-mediated signaling in B-cells and FCGR1 (high affinity immunoglobulin gamma Fc receptor I)-mediated signaling in myeloid cells. Couples activation of these receptors and their associated kinases with distal intracellular events through the recruitment of GRB2.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_022964" in other vectors (4)
SKU Description Size Price
MC207535 Lat2 (untagged) - Mouse linker for activation of T cells family, member 2 (Lat2), transcript variant 2, (10ug) 10 ug
$330.00
MR201826 Lat2 (Myc-DDK-tagged) - Mouse linker for activation of T cells family, member 2 (Lat2), transcript variant 2 10 ug
$289.00 $300.00
MR201826L3 Lenti ORF clone of Lat2 (Myc-DDK-tagged) - Mouse linker for activation of T cells family, member 2 (Lat2), transcript variant 2 10 ug
$600.00
MR201826L4 Lenti ORF clone of Lat2 (mGFP-tagged) - Mouse linker for activation of T cells family, member 2 (Lat2), transcript variant 2 10 ug
$600.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.