OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Rbm8a (NM_025875) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG201494
Rbm8a (tGFP-tagged) - Mouse RNA binding motif protein 8a (Rbm8a)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP tGFP DDK
  $500.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Rbm8a or NM_025875"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Rbm8a
Synonyms 2310057C03Rik; AA673428; Rbm8
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG201494 representing NM_025875
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGACGTGCTGGATCTTCACGAGGCGGGGGGCGAAGATTTCGCCATGGATGAGGATGGGGACGAAA
GCATCCACAAACTAAAAGAAAAAGCAAAGAAACGGAAGGGCCGCGGCTTTGGCTCCGAGGGGTCCCGAGC
GCGGATGCGGGAGGATTACGACAGTGTGGAGCAGGACGGCGATGAACCTGGACCACAGCGCTCTGTTGAA
GGTTGGATTCTCTTTGTCACTGGAGTCCACGAAGAAGCCACTGAAGAAGATATCCATGACAAATTCGCTG
AATATGGGGAAATAAAAAATATTCACCTTAATTTGGACAGGCGCACGGGATACTTGAAGGGGTATACTCT
AGTTGAATATGAAACATACAAAGAGGCTCAGGCTGCCATGGAAGGACTAAATGGTCAAGATTTGATGGGG
CAGCCAATCAGTGTGGACTGGTGTTTTGTTCGTGGACCACCAAAGGGCAAGAGGAGAGGAGGCCGAAGAC
GAAGCAGGAGTCCAGACCGGAGACGCCGT

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG201494 representing NM_025875
Red=Cloning site Green=Tags(s)

MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEGSRARMREDYDSVEQDGDEPGPQRSVE
GWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMG
QPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_025875
ORF Size 519 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_025875.2, NP_080151.2
RefSeq Size 1728 bp
RefSeq ORF 522 bp
Locus ID 60365
UniProt ID Q9CWZ3
Cytogenetics 3 F2.1
Summary Required for pre-mRNA splicing as component of the spliceosome (By similarity). Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs. The EJC is a dynamic structure consisting of core proteins and several peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. The EJC marks the position of the exon-exon junction in the mature mRNA for the gene expression machinery and the core components remain bound to spliced mRNAs throughout all stages of mRNA metabolism thereby influencing downstream processes including nuclear mRNA export, subcellular mRNA localization, translation efficiency and nonsense-mediated mRNA decay (NMD). Its removal from cytoplasmic mRNAs requires translation initiation from EJC-bearing spliced mRNAs. Associates preferentially with mRNAs produced by splicing. Does not interact with pre-mRNAs, introns, or mRNAs produced from intronless cDNAs. Associates with both nuclear mRNAs and newly exported cytoplasmic mRNAs (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_025875" in other vectors (5)
SKU Description Size Price
MC201215 Rbm8a (untagged) - Mouse RNA binding motif protein 8a (Rbm8a), transcript variant 2, (10ug) 10 ug
$300.00
MG218181 Rbm8a (tGFP-tagged) - Mouse RNA binding motif protein 8a (Rbm8a) transcript variant 2, (10ug) 10 ug
$530.00
MR218181 Rbm8a (Myc-DDK-tagged) - Mouse RNA binding motif protein 8a (Rbm8a), transcript variant 2 10 ug
$330.00
MR218181L3 Lenti ORF clone of Rbm8a (Myc-DDK-tagged) - Mouse RNA binding motif protein 8a (Rbm8a), transcript variant 2 10 ug
$630.00
MR218181L4 Lenti ORF clone of Rbm8a (mGFP-tagged) - Mouse RNA binding motif protein 8a (Rbm8a), transcript variant 2 10 ug
$630.00

Plasmid Map for MG201494

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MG201494
Circular map for MG201494

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products