OriGene Logo

Iscu (NM_025526) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG201379
Iscu (tGFP-tagged) - Mouse IscU iron-sulfur cluster scaffold homolog (E. coli) (Iscu)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $500.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Iscu or NM_025526"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Iscu
Synonyms 2310020H20Rik; AA407971; Nifu; Nifun
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG201379 representing NM_025526
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGGCCACGGGAGCTGGCCGTCTGAGGCGGGCGGCGTCGGCGCTGCTGCTGCGGAGCCCGCGCC
TGCCCGCCCGGGAGCTGTCGGCTCCGGCCAGGCTCTACCACAAGAAGGTTGTGGATCATTATGAAAACCC
TCGGAACGTGGGATCCCTTGACAAGACATCTAAAAATGTTGGAACCGGATTGGTGGGGGCTCCGGCATGT
GGTGACGTCATGAAACTGCAGATCCAGGTGGATGAAAAGGGGAAGATTGTGGACGCCAGATTCAAAACAT
TTGGCTGCGGCTCCGCCATTGCCTCCAGCTCCTTAGCCACAGAGTGGGTAAAGGGGAAAACGGTGGAGGA
AGCCCTGACCATCAAAAACACCGACATCGCCAAGGAGCTCTGCCTGCCGCCTGTGAAACTGCACTGCTCC
ATGCTGGCAGAAGACGCCATCAAGGCCGCCCTGGCTGACTACAAACTGAAGCAAGAGTCCAAGAAGGAGG
AGCCAGAGAAGCAG

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG201379 representing NM_025526
Red=Cloning site Green=Tags(s)

MAAATGAGRLRRAASALLLRSPRLPARELSAPARLYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPAC
GDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCS
MLAEDAIKAALADYKLKQESKKEEPEKQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_025526
ORF Size 504 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_025526.5
RefSeq Size 885 bp
RefSeq ORF 507 bp
Locus ID 66383
UniProt ID Q9D7P6
Cytogenetics 5 F
Summary Scaffold protein for the de novo synthesis of iron-sulfur (Fe-S) clusters within mitochondria, which is required for maturation of both mitochondrial and cytoplasmic 2Fe-2S and 4Fe-4S proteins. First, a 2Fe-2S cluster is transiently assembled on the scaffold protein ISCU. In a second step, the cluster is released from ISCU, transferred to a glutaredoxin GLRX5, followed by the formation of mitochondrial 2Fe-2S proteins, the synthesis of 4Fe-4S clusters and their target-specific insertion into the recipient apoproteins. Cluster assembly on ISCU depends on the function of the cysteine desulfurase complex NFS1-LYRM4/ISD11, which serves as the sulfur donor for cluster synthesis, the iron-binding protein frataxin as the putative iron donor, and the electron transfer chain comprised of ferredoxin reductase and ferredoxin, which receive their electrons from NADH (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_025526" in other vectors (4)
SKU Description Size Price
MC205875 Iscu (untagged) - Mouse IscU iron-sulfur cluster scaffold homolog (E. coli) (Iscu), nuclear gene encoding mitochondrial protein, (10ug) 10 ug
$300.00
MR201379 Iscu (Myc-DDK-tagged) - Mouse IscU iron-sulfur cluster scaffold homolog (E. coli) (Iscu), nuclear gene encoding mitochondrial protein 10 ug
$289.00 $300.00
MR201379L3 Lenti ORF clone of Iscu (Myc-DDK-tagged) - Mouse IscU iron-sulfur cluster scaffold homolog (E. coli) (Iscu), nuclear gene encoding mitochondrial protein 10 ug
$600.00
MR201379L4 Lenti ORF clone of Iscu (mGFP-tagged) - Mouse IscU iron-sulfur cluster scaffold homolog (E. coli) (Iscu), nuclear gene encoding mitochondrial protein 10 ug
$600.00

Welcome to OriGene AI!

I'm your AI-powered guide to everything OriGene.
Ask me anything:

  • Product specs
  • Ordering help
  • Technical questions
  • How to find exactly what your experiment needs

Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.

Velaro Chat Img

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.