Ier3 (NM_133662) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG201231
Ier3 (tGFP-tagged) - Mouse immediate early response 3 (Ier3)
  $425.00
3 Weeks*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Ier3
Synonyms AI663993; cI-3; gly96; IEX-1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG201231 representing NM_133662
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGCCACTCGCGCAACCATCTCCACACCATGACTGGCCTGAGGGCCCCTTCTCCAGCTCCCTCCACCG
GCCCGGAACTCCGGCGGGGCTCTGGTCCCGAGATTTTCACCTTCGACCCTCTCCCGGAGCGGGCCGTGGT
GTCCACCGCGCGTTTGAACACTTCTCGCGGGCACCGAAAACGCAGCCGAAGGGTGCTCTACCCTCGAGTG
GTCCGGCGCCAGCTACCAACCGAGGAACCCAACATTGCCAAGAGGGTCCTCTTTCTCCTGTTCGCCATCA
TCTTCTGCCAGATTTTGATGGCTGAAGAGGGTGTGTCGCAGCCCCTGGCTCCGGAGGATGCTACCAGCGC
CGTGACACCTGAGCCCATTTCTGCGCCCATTACTGCGCCCCCGGTCCTCGAGCCTTTGAACCTGACCTCG
GAGTCCTCGGATTATGCGCTGGATCTTAAAGCTTTTCTCCAGCAACATCCGGCGGCCTTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG201231 representing NM_133662
Red=Cloning site Green=Tags(s)

MCHSRNHLHTMTGLRAPSPAPSTGPELRRGSGPEIFTFDPLPERAVVSTARLNTSRGHRKRSRRVLYPRV
VRRQLPTEEPNIAKRVLFLLFAIIFCQILMAEEGVSQPLAPEDATSAVTPEPISAPITAPPVLEPLNLTS
ESSDYALDLKAFLQQHPAAF

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_133662
ORF Size 480 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_133662.1
RefSeq Size 1090 bp
RefSeq ORF 483 bp
Locus ID 15937
Cytogenetics 17 B1
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_133662" in other vectors (5)
SKU Description Size Price
MR201231 Ier3 (Myc-DDK-tagged) - Mouse immediate early response 3 (Ier3) 10 ug
$225.00
MR201231L1 Lenti ORF clone of Ier3 (Myc-DDK-tagged) - Mouse immediate early response 3 (Ier3) 10 ug
$525.00
MR201231L2 Lenti ORF clone of Ier3 (mGFP-tagged) - Mouse immediate early response 3 (Ier3) 10 ug
$525.00
MR201231L3 Lenti ORF clone of Ier3 (Myc-DDK-tagged) - Mouse immediate early response 3 (Ier3) 10 ug
$525.00
MR201231L4 Lenti ORF clone of Ier3 (mGFP-tagged) - Mouse immediate early response 3 (Ier3) 10 ug
$525.00

Welcome to OriGene AI!

I'm your AI-powered guide to everything OriGene.
Ask me anything:

  • Product specs
  • Ordering help
  • Technical questions
  • How to find exactly what your experiment needs

Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.

Velaro Chat Img

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.