OriGene Logo

Maff (NM_010755) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG201170
Maff (tGFP-tagged) - Mouse v-maf musculoaponeurotic fibrosarcoma oncogene family, protein F (avian) (Maff)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $350.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Maff or NM_010755"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Maff
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG201170 representing NM_010755
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGTGGATCCCTTATCTAGCAAAGCCCTGAAGGTCAAGCGCGAGTTGAGCGAGAACACGCCGCACC
TGTCGGATGAAGCGCTGATGGGGCTGTCGGTGCGCGAGCTGAACCGCAACCTGCGCGGGCTGTCGGCGGA
GGAGGTGACGCGGCTGAAGCAGCGGCGCCGCACACTCAAGAACCGCGGCTACGCGGCCAGCTGCCGCGTG
AAGCGCGTGTGCCAGAAGGAGGAGCTGCAGAAGCAGAAGTCCGAGCTGGAGCGCGAGGTGGACAAGCTGG
CGCGCGAGAACGCCGCCATGCGCCTGGAGCTCGACGCGCTGCGCGGCAAGTGTGAAGCGCTGCAGGGCTT
CGCGCGCTCCGTGGCCGCCGCCCGCGGGCCCGCCGCACTGGTGGCGCCCGCCAGCGTCATCACCATCGTC
AAGTCGGCGCCGGGCCCAGCCCCTGCTGCTGACCCCGCCCCCTGCTCC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG201170 representing NM_010755
Red=Cloning site Green=Tags(s)

MAVDPLSSKALKVKRELSENTPHLSDEALMGLSVRELNRNLRGLSAEEVTRLKQRRRTLKNRGYAASCRV
KRVCQKEELQKQKSELEREVDKLARENAAMRLELDALRGKCEALQGFARSVAAARGPAALVAPASVITIV
KSAPGPAPAADPAPCS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_010755
ORF Size 468 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_010755.4
RefSeq Size 1800 bp
RefSeq ORF 471 bp
Locus ID 17133
UniProt ID O54791
Cytogenetics 15 37.7 cM
Summary Since they lack a putative transactivation domain, the small Mafs behave as transcriptional repressors when they dimerize among themselves. However, they seem to serve as transcriptional activators by dimerizing with other (usually larger) basic-zipper proteins, such as NFE2L1/NRF1, and recruiting them to specific DNA-binding sites. Interacts with the upstream promoter region of the oxytocin receptor gene. May be a transcriptional enhancer in the up-regulation of the oxytocin receptor gene at parturition.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_010755" in other vectors (4)
SKU Description Size Price
MC204060 Maff (untagged) - Mouse v-maf musculoaponeurotic fibrosarcoma oncogene family, protein F (avian) (Maff), (10ug) 10 ug
$150.00
MR201170 Maff (Myc-DDK-tagged) - Mouse v-maf musculoaponeurotic fibrosarcoma oncogene family, protein F (avian) (Maff) 10 ug
$289.00
MR201170L3 Lenti ORF clone of Maff (Myc-DDK-tagged) - Mouse v-maf musculoaponeurotic fibrosarcoma oncogene family, protein F (avian) (Maff) 10 ug
$450.00
MR201170L4 Lenti ORF clone of Maff (mGFP-tagged) - Mouse v-maf musculoaponeurotic fibrosarcoma oncogene family, protein F (avian) (Maff) 10 ug
$450.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.