Srgn (NM_011157) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG201094
Srgn (tGFP-tagged) - Mouse serglycin (Srgn)
  $489.00
In Stock*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Srgn
Synonyms Prg; Prg1; Sgc
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG201094 representing NM_011157
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGGTTCCCGTCGGCAGCAGGCTTGTCCTGGCTCTCGCCTTCGTCCTGGTTTGGGGATCTTCAGTGC
AAGGTTATCCTGCTCGGAGAGCCAGGTACCAGTGGGTCCGCTGCAAACCGAATGGCTTTTTTGCGAACTG
CATCGAGGAGAAGGGACCACAGTTTGACCTAATAGATGAATCCAATAACATCGGCCCTCCCATGAATAAT
CCTGTTTTGATGGAAGGACCCTCAAAAGATTTCATCTCCAATTATGATGACTATGGGTCAGGTTCGGGCT
CCGGCTCTGGCTCCGGCTCTGGCTCGGGTTCCGGCTCCGGAAGTGGCTTCCTAGGTGACATGGAATGGGA
ATACCAGCCAACAGATGAAAGCAATATTGTCTATTTCAACTATAAGCCTTTTGACAGGATTCTCACTGAG
CAAAACCAAGACCAACCAGAAGACGATTTTATTATA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG201094 representing NM_011157
Red=Cloning site Green=Tags(s)

MQVPVGSRLVLALAFVLVWGSSVQGYPARRARYQWVRCKPNGFFANCIEEKGPQFDLIDESNNIGPPMNN
PVLMEGPSKDFISNYDDYGSGSGSGSGSGSGSGSGSGSGFLGDMEWEYQPTDESNIVYFNYKPFDRILTE
QNQDQPEDDFII

TRTRPLE - GFP Tag - V
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_011157
ORF Size 456 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_011157.3
RefSeq Size 938 bp
RefSeq ORF 459 bp
Locus ID 19073
UniProt ID P13609
Cytogenetics 10 B4
Summary Plays a role in formation of mast cell secretory granules and mediates storage of various compounds in secretory vesicles. Required for storage of some proteases in both connective tissue and mucosal mast cells and for storage of granzyme B in T-lymphocytes. Plays a role in localizing neutrophil elastase in azurophil granules of neutrophils. Mediates processing of MMP2. Plays a role in cytotoxic cell granule-mediated apoptosis by forming a complex with granzyme B which is delivered to cells by perforin to induce apoptosis. Regulates the secretion of TNF-alpha and may also regulate protease secretion. Inhibits bone mineralization.UniProtKB/Swiss-Prot Function
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_011157" in other vectors (4)
SKU Description Size Price
MC207356 Srgn (untagged) - Mouse serglycin (Srgn), (10ug) 10 ug
$165.00
MR201094 Srgn (Myc-DDK-tagged) - Mouse serglycin (Srgn) 10 ug
$289.00
MR201094L3 Lenti ORF clone of Srgn (Myc-DDK-tagged) - Mouse serglycin (Srgn) 10 ug
$450.00
MR201094L4 Lenti ORF clone of Srgn (mGFP-tagged) - Mouse serglycin (Srgn) 10 ug
$450.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.