OriGene Logo

Ube2w (NM_025773) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG201089
Ube2w (tGFP-tagged) - Mouse ubiquitin-conjugating enzyme E2W (putative) (Ube2w)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $350.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Ube2w or NM_025773"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Ube2w
Synonyms 6130401J04Rik
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG201089 representing NM_025773
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTCAATGCAGAAACGACTACAAAAAGAACTGTTGGCTTTGCAGAATGACCCACCTCCTGGAATGA
CTTTAAATGAAAAGAGTGTTCAGAATTCAATCACGCAGTGGATCGTAGACATGGAAGGTGCACCAGGAAC
CTTATATGAAGGGGAAAAATTTCAACTTTTGTTTAAATTTAGTAGTCGATACCCTTTTGACTCTCCTCAG
GTCATGTTTACTGGTGAAAATATTCCCATTCATCCTCATGTGTATAGCAATGGTCATATCTGTTTATCCA
TTCTAACAGAAGACTGGTCCCCGGCGCTCTCAGTGCAGTCAGTCTGTCTCAGCATTATCAGCATGCTTTC
CAGCTGCAAAGAAAAGAGACGACCACCAGATAATTCCTTTTATGTGCGAACATGTAACAAGAATCCAAAG
AAAACAAAATGGTGGTATCATGATGACACTTGT

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG201089 representing NM_025773
Red=Cloning site Green=Tags(s)

MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQ
VMFTGENIPIHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPK
KTKWWYHDDTC

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_025773
ORF Size 453 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_025773.4
RefSeq Size 2355 bp
RefSeq ORF 543 bp
Locus ID 66799
UniProt ID Q8VDW4
Cytogenetics 1 A3
Summary Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Specifically monoubiquitinates the N-terminus of various substrates, including ATXN3, MAPT/TAU, POLR2H/RPB8 and STUB1/CHIP, by recognizing backbone atoms of disordered N-termini (PubMed:21855799, PubMed:21229326). Involved in degradation of misfolded chaperone substrates by mediating monoubiquitination of STUB1/CHIP, leading to recruitment of ATXN3 to monoubiquitinated STUB1/CHIP, and restriction of the length of ubiquitin chain attached to STUB1/CHIP substrates by ATXN3 (PubMed:21855799). After UV irradiation, but not after mitomycin-C (MMC) treatment, acts as a specific E2 ubiquitin-conjugating enzyme for the Fanconi anemia complex by associating with E3 ubiquitin-protein ligase FANCL and catalyzing monoubiquitination of FANCD2, a key step in the DNA damage pathway (PubMed:21229326). In vitro catalyzes 'Lys-11'-linked polyubiquitination. UBE2W-catalyzed ubiquitination occurs also in the presence of inactive RING/U-box type E3s, i.e. lacking the active site cysteine residues to form thioester bonds with ubiquitin, or even in the absence of E3, albeit at a slower rate (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_025773" in other vectors (4)
SKU Description Size Price
MC207595 Ube2w (untagged) - Mouse ubiquitin-conjugating enzyme E2W (putative) (Ube2w), (10ug) 10 ug
$330.00
MR201089 Ube2w (Myc-DDK-tagged) - Mouse ubiquitin-conjugating enzyme E2W (putative) (Ube2w) 10 ug
$289.00
MR201089L3 Lenti ORF clone of Ube2w (Myc-DDK-tagged) - Mouse ubiquitin-conjugating enzyme E2W (putative) (Ube2w) 10 ug
$450.00
MR201089L4 Lenti ORF clone of Ube2w (mGFP-tagged) - Mouse ubiquitin-conjugating enzyme E2W (putative) (Ube2w) 10 ug
$450.00

Welcome to OriGene AI!

I'm your AI-powered guide to everything OriGene.
Ask me anything:

  • Product specs
  • Ordering help
  • Technical questions
  • How to find exactly what your experiment needs

Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.

Velaro Chat Img

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.