OriGene Logo

Ostc (NM_025509) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG201040
Ostc (tGFP-tagged) - Mouse RIKEN cDNA 2310008M10 gene (2310008M10Rik)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $350.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Ostc or NM_025509"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Ostc
Synonyms 2310008M10Rik; 5730557H03Rik
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG201040 representing NM_025509
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGACTCTGTACCGAGTCCCATTCTTAGTGCTCGAATGCCCCAACCTGAAGCTGAAGAAACCGCCCT
GGGTGCACATGCCGTCGGCTATGACGGTGTACGCCCTGGTGGTGGTATCTTACTTCCTCATTACCGGAGG
AATAATCTATGATGTTATCGTTGAACCTCCAAGTGTTGGCTCAATGACCGACGAACATGGGCATCAGAGA
CCAGTAGCTTTCTTGGCTTACAGAGTAAACGGACAGTATATCATGGAAGGGCTTGCGTCCAGCTTTCTCT
TTACAATGGGAGGTTTAGGTTTCATAATCCTGGACCGATCCAATGCACCAAACATACCGAAACTCAACAG
GTTTCTTCTTCTGTTCATCGGCTTCGTCTGTGTTCTCCTGAGTTTCTTCATGGCCAGAGTGTTCATGAGA
ATGAAATTGCCGGGCTACCTGATGGGC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG201040 representing NM_025509
Red=Cloning site Green=Tags(s)

METLYRVPFLVLECPNLKLKKPPWVHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTDEHGHQR
PVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVCVLLSFFMARVFMR
MKLPGYLMG

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_025509
ORF Size 447 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_025509.2, NP_079785.1
RefSeq Size 1066 bp
RefSeq ORF 450 bp
Locus ID 66357
UniProt ID Q78XF5
Cytogenetics 3 G3
Summary Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity. May be involved in N-glycosylation of APP (amyloid-beta precursor protein). Can modulate gamma-secretase cleavage of APP by enhancing endoprotelysis of PSEN1.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_025509" in other vectors (4)
SKU Description Size Price
MC201780 Ostc (untagged) - Mouse oligosaccharyltransferase complex subunit (Ostc), (10ug) 10 ug
$150.00
MR201040 Ostc (Myc-DDK-tagged) - Mouse oligosaccharyltransferase complex subunit (Ostc) 10 ug
$289.00
MR201040L3 Lenti ORF clone of Ostc (Myc-DDK-tagged) - Mouse oligosaccharyltransferase complex subunit (Ostc) 10 ug
$450.00
MR201040L4 Lenti ORF clone of Ostc (mGFP-tagged) - Mouse oligosaccharyltransferase complex subunit (Ostc) 10 ug
$450.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.