Tnfrsf12a (NM_013749) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG200721
Tnfrsf12a (tGFP-tagged) - Mouse tumor necrosis factor receptor superfamily, member 12a (Tnfrsf12a)
  $489.00
In Stock*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Tnfrsf12a
Synonyms AI255180; C87282; Fn14; HPIP; TWEAK-R; TweakR
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200721 representing NM_013749
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTCGGCTTGGCCGCGGTCTCTGCCGCAGATCCTCGTGTTGGGATTCGGCTTGGTGTTGATGCGCG
CCGCGGCCGGGGAGCAAGCACCAGGCACCTCCCCATGCTCTAGCGGCAGCTCCTGGAGCGCGGACCTCGA
CAAGTGCATGGACTGCGCTTCTTGTCCAGCGCGACCACACAGCGACTTCTGCCTGGGATGCGCCGCAGCA
CCTCCTGCCCACTTCAGGCTACTGTGGCCCATTCTGGGGGGCGCTCTTAGTCTGGTCCTGGTTTTGGCGC
TGGTTTCTAGTTTCCTGGTCTGGAGAAGATGCCGCCGGAGAGAAAAGTTTACTACCCCCATAGAGGAGAC
TGGTGGAGAGGGCTGCCCAGGTGTGGCACTGATCCAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200721 representing NM_013749
Red=Cloning site Green=Tags(s)

MASAWPRSLPQILVLGFGLVLMRAAAGEQAPGTSPCSSGSSWSADLDKCMDCASCPARPHSDFCLGCAAA
PPAHFRLLWPILGGALSLVLVLALVSSFLVWRRCRRREKFTTPIEETGGEGCPGVALIQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_013749
ORF Size 387 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_013749.2
RefSeq Size 968 bp
RefSeq ORF 390 bp
Locus ID 27279
UniProt ID Q9CR75
Cytogenetics 17 A3.3
Summary Receptor for TNFSF12/TWEAK (By similarity). Weak inducer of apoptosis in some cell types. Promotes angiogenesis and the proliferation of endothelial cells. May modulate cellular adhesion to matrix proteins.UniProtKB/Swiss-Prot Function
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_013749" in other vectors (6)
SKU Description Size Price
MC201655 Tnfrsf12a (untagged) - Mouse tumor necrosis factor receptor superfamily, member 12a (Tnfrsf12a), transcript variant 1, (10ug) 10 ug
$150.00
MR200721 Tnfrsf12a (Myc-DDK-tagged) - Mouse tumor necrosis factor receptor superfamily, member 12a (Tnfrsf12a), transcript variant 1 10 ug
$289.00
MR200721L1 Lenti ORF clone of Tnfrsf12a (Myc-DDK-tagged) - Mouse tumor necrosis factor receptor superfamily, member 12a (Tnfrsf12a), transcript variant 1 10 ug
$450.00
MR200721L2 Lenti ORF clone of Tnfrsf12a (mGFP-tagged) - Mouse tumor necrosis factor receptor superfamily, member 12a (Tnfrsf12a), transcript variant 1 10 ug
$450.00
MR200721L3 Lenti ORF clone of Tnfrsf12a (Myc-DDK-tagged) - Mouse tumor necrosis factor receptor superfamily, member 12a (Tnfrsf12a), transcript variant 1 10 ug
$450.00
MR200721L4 Lenti ORF clone of Tnfrsf12a (mGFP-tagged) - Mouse tumor necrosis factor receptor superfamily, member 12a (Tnfrsf12a), transcript variant 1 10 ug
$450.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.