Tafa5 (NM_134096) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG200644
Fam19a5 (tGFP-tagged) - Mouse expressed sequence AW049604 (AW049604)
  $350.00
3 Weeks*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Tafa5
Synonyms Fam19; Fam19a5; Tafa-5; Tar; Tara-5
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200644 representing NM_134096
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGCTCCTGAAGGCGCTCTGGGCACTCGCAGGGGCCGCGCTCTGCTGCTTCCTCGTCCTGGTGATTC
ACGCGCAGTTCCTCAAAGAAGGTCAGCTGGCCGCTGGAACCTGTGAGATTGTGACCCTAGACCGGGACAG
CAGCCAGCCACGGAGGACGATCGCCCGGCAGACAGCACGCTGTGCATGCAGAAAGGGGCAGATAGCAGGC
ACCACTCGAGCCCGGCCTGCTTGTGTGGACGCTCGAATTATCAAGACAAAGCAGTGGTGTGACATGCTTC
CTTGCCTGGAGGGGGAAGGCTGTGACTTGTTAATCAACCGGTCAGGCTGGACTTGCACACAGCCCGGAGG
GCGGATAAAGACCACCACGGTCTCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200644 representing NM_134096
Red=Cloning site Green=Tags(s)

MQLLKALWALAGAALCCFLVLVIHAQFLKEGQLAAGTCEIVTLDRDSSQPRRTIARQTARCACRKGQIAG
TTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLINRSGWTCTQPGGRIKTTTVS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_134096
ORF Size 375 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_134096.2, NP_598857.1
RefSeq Size 2617 bp
RefSeq ORF 378 bp
Locus ID 106014
UniProt ID Q91WE9
Cytogenetics 15 E3
Summary This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. provided by RefSeq, Nov 2011
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_134096" in other vectors (4)
SKU Description Size Price
MC212122 Fam19a5 (untagged) - Mouse family with sequence similarity 19, member A5 (Fam19a5), (10ug) 10 ug
$165.00
MR200644 Fam19a5 (Myc-DDK-tagged) - Mouse family with sequence similarity 19, member A5 (Fam19a5) 10 ug
$289.00
MR200644L3 Lenti ORF clone of Fam19a5 (Myc-DDK-tagged) - Mouse family with sequence similarity 19, member A5 (Fam19a5) 10 ug
$450.00
MR200644L4 Lenti ORF clone of Fam19a5 (mGFP-tagged) - Mouse family with sequence similarity 19, member A5 (Fam19a5) 10 ug
$450.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.