Phf5a (NM_026737) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG200425
Phf5a (tGFP-tagged) - Mouse PHD finger protein 5A (Phf5a)
  $350.00
3 Weeks*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Phf5a
Synonyms 1110007B08Rik
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200425 representing NM_026737
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTAAACATCATCCAGATTTGATTTTCTGCCGCAAGCAGGCTGGTGTGGCTATCGGAAGACTGTGTG
AAAAATGTGACGGCAAGTGTGTGATCTGTGATTCCTACGTGCGTCCCTGCACCCTGGTCCGCATATGTGA
TGAGTGTAACTATGGATCTTACCAGGGCCGGTGTGTAATCTGTGGCGGCCCCGGAGTCTCCGATGCCTAC
TACTGTAAAGAGTGCACCATTCAGGAGAAGGATAGAGATGGTTGTCCAAAGATTGTCAATTTGGGGAGCT
CTAAGACAGACCTGTTCTATGAACGCAAAAAATACGGCTTCAAGAAGAGG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200425 representing NM_026737
Red=Cloning site Green=Tags(s)

MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAY
YCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_026737
ORF Size 330 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_026737.3, NP_081013.1
RefSeq Size 1648 bp
RefSeq ORF 333 bp
Locus ID 68479
UniProt ID P83870
Cytogenetics 15 E1
Summary Involved with the PAF1 complex (PAF1C) in transcriptional elongation by RNA polymerase II, and in regulation of development and maintenance of embryonic stem cell (ESC) pluripotency. Required for maintenance of ESCs self-renewal and cellular reprogramming of stem cells. Maintains pluripotency by recruiting and stabilizing PAF1C on pluripotency genes loci, and by regulating the expression of the pluripotency genes. Regulates the deposition of elongation-associated histone modifications, including dimethylated histone H3 'Lys-79' (H3K79me2) and trimethylated histone H3 'Lys-36' (H3K36me3), on PAF1C targets, self-renewal and pluripotency genes. Regulates RNA polymerase II promoter-proximal pause release of the PAF1C targets and self-renewal genes, and the levels of elongating ('Ser-2' phosphorylated) RNA polymerase II in their gene bodies. Regulates muscle specification in adult stem cells by stabilizing PAF1C in chromatin to promote myogenic differentiation (PubMed:27749823). Involved in pre-mRNA splicing as a component of the splicing factor SF3B complex. SF3B complex is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA (By similarity). Acts as a transcriptional regulator by binding to the GJA1/Cx43 promoter and enhancing its up-regulation by ESR1/ER-alpha (By similarity).UniProtKB/Swiss-Prot Function
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_026737" in other vectors (4)
SKU Description Size Price
MC202248 Phf5a (untagged) - Mouse PHD finger protein 5A (Phf5a), (10ug) 10 ug
$150.00
MR200425 Phf5a (Myc-DDK-tagged) - Mouse PHD finger protein 5A (Phf5a) 10 ug
$289.00
MR200425L3 Lenti ORF clone of Phf5a (Myc-DDK-tagged) - Mouse PHD finger protein 5A (Phf5a) 10 ug
$450.00
MR200425L4 Lenti ORF clone of Phf5a (mGFP-tagged) - Mouse PHD finger protein 5A (Phf5a) 10 ug
$450.00

Welcome to OriGene AI!

I'm your AI-powered guide to everything OriGene.
Ask me anything:

  • Product specs
  • Ordering help
  • Technical questions
  • How to find exactly what your experiment needs

Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.

Velaro Chat Img

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.