OriGene Logo

Fxyd6 (NM_022004) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG200251
Fxyd6 (tGFP-tagged) - Mouse FXYD domain-containing ion transport regulator 6 (Fxyd6)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $350.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Fxyd6 or NM_022004"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Fxyd6
Synonyms 0610030I18Rik; P; Php
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200251 representing NM_022004
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGACGGTGCTGGTCCTCTGCAGCTTGCTGGCCCCTGTGGTCCTGGCGAGTGCTGAGAAGGAGAAAG
AAAAGGATCCTTTCTATTACGACTACCAGACCCTGAGGATTGGGGGGTTGGTGTTTGCTGTGGTCCTCTT
CTCCGTTGGGATACTTCTCATCCTCAGTCGCAGGTGCAAGTGCAGTTTCAATCAGAAGCCCAGGGCTCCA
GGTGACGAAGAGGCCCAGGTGGAGAACCTCATCACTACAAACGCTGCGGAGCCCCAGAAGGCAGAGAAC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200251 representing NM_022004
Red=Cloning site Green=Tags(s)

METVLVLCSLLAPVVLASAEKEKEKDPFYYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPRAP
GDEEAQVENLITTNAAEPQKAEN

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_022004
ORF Size 279 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_022004.6, NP_071287.1
RefSeq Size 1804 bp
RefSeq ORF 285 bp
Locus ID 59095
UniProt ID Q9D164
Cytogenetics 9 A5.2
Summary This reference sequence was derived from multiple replicate ESTs and validated by similar human genomic sequence. This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. This gene product, Fxyd6, is novel and has not been characterized as a protein. RefSeq curation by Kathleen J. Sweadner, Ph.D., sweadner@helix.mgh.harvard.edu., Jul 2006
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_022004" in other vectors (4)
SKU Description Size Price
MC210195 Fxyd6 (untagged) - Mouse FXYD domain-containing ion transport regulator 6 (Fxyd6), (10ug) 10 ug
$165.00
MR200251 Fxyd6 (Myc-DDK-tagged) - Mouse FXYD domain-containing ion transport regulator 6 (Fxyd6) 10 ug
$289.00
MR200251L3 Lenti ORF clone of Fxyd6 (Myc-DDK-tagged) - Mouse FXYD domain-containing ion transport regulator 6 (Fxyd6) 10 ug
$450.00
MR200251L4 Lenti ORF clone of Fxyd6 (mGFP-tagged) - Mouse FXYD domain-containing ion transport regulator 6 (Fxyd6) 10 ug
$450.00

Welcome to OriGene AI!

I'm your AI-powered guide to everything OriGene.
Ask me anything:

  • Product specs
  • Ordering help
  • Technical questions
  • How to find exactly what your experiment needs

Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.

Velaro Chat Img

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.