OriGene Logo

Apoc1 (NM_007469) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG200207
Apoc1 (tGFP-tagged) - Mouse apolipoprotein C-I (Apoc1)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP tGFP DDK
AAV Particle:
DDK
  $350.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Apoc1 or NM_007469"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Apoc1
Synonyms apo-CI; Apo-CIB; apoC-I; ApoC-IB
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200207 representing NM_007469
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGCTCTTCATCGCTCTTCCTGTCCTGATTGTGGTCGTAGCCATGACCTTGGAAGGCCCAGCCCCCG
CCCAGGCGGCCCCGGATTTGTCCGGAACATTGGAGAGCATACCGGATAAACTGAAGGAGTTTGGGAACAC
TTTGGAAGACAAGGCCCGGGCAGCCATTGAACATATCAAACAGAAGGAAATTTTGACCAAGACCCGGGCC
TGGTTCTCAGAGGCATTTGGCAAAGTGAAGGAGAAGTTGAAGACCACGTTCTCC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200207 representing NM_007469
Red=Cloning site Green=Tags(s)

MRLFIALPVLIVVVAMTLEGPAPAQAAPDLSGTLESIPDKLKEFGNTLEDKARAAIEHIKQKEILTKTRA
WFSEAFGKVKEKLKTTFS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_007469
ORF Size 264 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007469.5
RefSeq Size 464 bp
RefSeq ORF 267 bp
Locus ID 11812
UniProt ID P34928
Cytogenetics 7 9.94 cM
Summary This gene encodes a precursor plasma protein that is cleaved to yield a signal peptide and two alternatively processed mature peptides. The encoded protein, which is a component of chylomicrons, very low density lipoproteins and high density lipoproteins, transports lipids from the intestines to other locations in the body. This protein binds to free fatty acids preventing their uptake by cells. This protein is a cofactor for lecithin cholesterol acyltransferase, an enzyme that catalyzes the conversion of free cholesterol to cholesteryl esters. The encoded protein inhibits the activity of the cholesteryl ester transfer protein which promotes the exchange of neutral lipids between lipoproteins. In humans this gene is associated with risk of coronary artery disease and age-associated memory impairment. Mice lacking this gene demonstrate impaired memory. This gene is clustered with three other apolipoprotein genes on chromosome 7. Alternative splicing results in multiple transcript variants. provided by RefSeq, Dec 2013
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_007469" in other vectors (5)
SKU Description Size Price
MC202950 Apoc1 (untagged) - Mouse apolipoprotein C-I (Apoc1), transcript variant 1, (10ug) 10 ug
$150.00
MG220182 Apoc1 (tGFP-tagged) - Mouse apolipoprotein C-I (Apoc1) transcript variant 1, (10ug) 10 ug
$350.00
MR220182 Apoc1 (Myc-DDK-tagged) - Mouse apolipoprotein C-I (Apoc1), transcript variant 1 10 ug
$289.00
MR220182L3 Lenti ORF clone of Apoc1 (Myc-DDK-tagged) - Mouse apolipoprotein C-I (Apoc1), transcript variant 1 10 ug
$450.00
MR220182L4 Lenti ORF clone of Apoc1 (mGFP-tagged) - Mouse apolipoprotein C-I (Apoc1), transcript variant 1 10 ug
$450.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.