Apln (NM_013912) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG200116
Apln (tGFP-tagged) - Mouse apelin (Apln)
  $489.00
In Stock*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Apln
Synonyms 6030430G11Rik; Apel
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200116 representing NM_013912
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATCTGAGGCTCTGCGTGCAGGCGCTGCTGCTGCTCTGGCTCTCCTTGACTGCAGTTTGTGGAGTGC
CACTGATGTTGCCTCCAGATGGAACAGGACTAGAAGAAGGAAGCATGCGCTACCTGGTGAAGCCCAGAAC
TTCGAGGACTGGACCAGGAGCCTGGCAGGGAGGCAGGAGGAAATTTCGCAGACAGCGCCCCCGGCTCTCC
CATAAGGGCCCCATGCCTTTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200116 representing NM_013912
Red=Cloning site Green=Tags(s)

MNLRLCVQALLLLWLSLTAVCGVPLMLPPDGTGLEEGSMRYLVKPRTSRTGPGAWQGGRRKFRRQRPRLS
HKGPMPF

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_013912
ORF Size 231 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_013912.4
RefSeq Size 3148 bp
RefSeq ORF 234 bp
Locus ID 30878
UniProt ID Q9R0R4
Cytogenetics X A5
Summary This gene encodes the neuropeptide Apelin, an endogenous ligand of the G protein-coupled receptor APJ. This gene is highly expressed in the central nervous system and peripheral tissues and the encoded preproprotein undergoes proteolytic processing to generate mature peptides of different sizes that are secreted into the plasma. These peptides play important roles in a broad range of physiological processes such as cardiac contractility, blood pressure, blood vessel growth, appetite and drink behavior, and pituitary hormone secretion. Mice lacking the encoded protein develop progressive heart failure and exhibit a shorter bleeding time, prothrombotic profile and increased bone mass. provided by RefSeq, Jul 2016
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_013912" in other vectors (4)
SKU Description Size Price
MC201204 Apln (untagged) - Mouse apelin (Apln), (10ug) 10 ug
$150.00
MR200116 Apln (Myc-DDK-tagged) - Mouse apelin (Apln) 10 ug
$289.00
MR200116L3 Lenti ORF clone of Apln (Myc-DDK-tagged) - Mouse apelin (Apln) 10 ug
$450.00
MR200116L4 Lenti ORF clone of Apln (mGFP-tagged) - Mouse apelin (Apln) 10 ug
$450.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.