OriGene Logo

Triap1 (NM_026933) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG200110
Triap1 (tGFP-tagged) - Mouse TP53 regulated inhibitor of apoptosis 1 (Triap1)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $350.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Triap1 or NM_026933"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Triap1
Synonyms 1810015M01Rik; AU020874; AU043831; P53csv; Wf-1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200110 representing NM_026933
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACAGCGTCGGGGAGGCTTGCACTGACATGAAGCGCGAGTACGACCAGTGCTTCAACCGCTGGTTTG
CTGAGAAGTTCCTCAAAGGGGACGGCTCCGGGGACCCGTGCACCGACCTCTTCAAACGCTACCAGCAGTG
CGTGCAGAAAGCAATCAAGGAGAAAGAGATTCCTATTGAAGGCCTGGAGTTCATGGGCCATGGCAAAGAA
AAGCCTGAAAACTCCTCT

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200110 representing NM_026933
Red=Cloning site Green=Tags(s)

MNSVGEACTDMKREYDQCFNRWFAEKFLKGDGSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKE
KPENSS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_026933
ORF Size 228 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_026933.3
RefSeq Size 1050 bp
RefSeq ORF 231 bp
Locus ID 69076
UniProt ID Q9D8Z2
Cytogenetics 5 F
Summary Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1:PRELID1 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space to provide PA for CL synthesis in the inner membrane. Likewise, the TRIAP1:PRELID3A complex mediates the transfer of phosphatidic acid (PA) between liposomes (in vitro) and probably functions as a PA transporter across the mitochondrion intermembrane space (in vivo). Mediates cell survival by inhibiting activation of caspase-9 which prevents induction of apoptosis.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_026933" in other vectors (4)
SKU Description Size Price
MC203198 Triap1 (untagged) - Mouse TP53 regulated inhibitor of apoptosis 1 (Triap1), (10ug) 10 ug
$150.00
MR200110 Triap1 (Myc-DDK-tagged) - Mouse TP53 regulated inhibitor of apoptosis 1 (Triap1) 10 ug
$289.00
MR200110L3 Lenti ORF clone of Triap1 (Myc-DDK-tagged) - Mouse TP53 regulated inhibitor of apoptosis 1 (Triap1) 10 ug
$450.00
MR200110L4 Lenti ORF clone of Triap1 (mGFP-tagged) - Mouse TP53 regulated inhibitor of apoptosis 1 (Triap1) 10 ug
$450.00

Welcome to OriGene AI!

I'm your AI-powered guide to everything OriGene.
Ask me anything:

  • Product specs
  • Ordering help
  • Technical questions
  • How to find exactly what your experiment needs

Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.

Velaro Chat Img

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.