Gtf2h5 (NM_181392) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG200081
Gtf2h5 (tGFP-tagged) - Mouse general transcription factor IIH, polypeptide 5 (Gtf2h5)
  $350.00
3 Weeks*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Gtf2h5
Synonyms 2700017P07Rik; 2810432H05Rik; D17Wsu155e
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200081 representing NM_181392
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTCAACGTGCTGAAAGGGGTGCTTATAGAATGTGACCCTGCCATGAAGCAGTTCTTGCTGTACTTGG
ATGAGGCCAACGCCTTGGGGAAGAAGTTCATCATTCAGGACATTGATGACACGCACGTCTTCGTCATTGC
CGAGCTGGTCAACGTCCTCCAGGAGCGAGTAGGGGAACTGATGGACCAGAATGCCTTTTCTCTTACCCAG
AAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200081 representing NM_181392
Red=Cloning site Green=Tags(s)

MVNVLKGVLIECDPAMKQFLLYLDEANALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQ
K

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_181392
ORF Size 213 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_181392.3
RefSeq Size 1129 bp
RefSeq ORF 216 bp
Locus ID 66467
UniProt ID Q8K2X8
Cytogenetics 17 3.7 cM
Summary Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module CAK controls the initiation of transcription. Necessary for the stability of the TFIIH complex and for the presence of normal levels of TFIIH in the cell.UniProtKB/Swiss-Prot Function
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_181392" in other vectors (4)
SKU Description Size Price
MC202230 Gtf2h5 (untagged) - Mouse general transcription factor IIH, polypeptide 5 (Gtf2h5), (10ug) 10 ug
$150.00
MR200081 Gtf2h5 (Myc-DDK-tagged) - Mouse general transcription factor IIH, polypeptide 5 (Gtf2h5) 10 ug
$289.00
MR200081L3 Lenti ORF clone of Gtf2h5 (Myc-DDK-tagged) - Mouse general transcription factor IIH, polypeptide 5 (Gtf2h5) 10 ug
$450.00
MR200081L4 Lenti ORF clone of Gtf2h5 (mGFP-tagged) - Mouse general transcription factor IIH, polypeptide 5 (Gtf2h5) 10 ug
$450.00

Welcome to OriGene AI!

I'm your AI-powered guide to everything OriGene.
Ask me anything:

  • Product specs
  • Ordering help
  • Technical questions
  • How to find exactly what your experiment needs

Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.

Velaro Chat Img

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.