NAP1L4 Rabbit Polyclonal Antibody

SKU TA344383

Rabbit Polyclonal Anti-NAP1L4 Antibody - N-terminal region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Nap1l4 antibody is: synthetic peptide directed towards the N-terminal region of Nap1l4. Synthetic peptide located within the following region: HDLERKYAALYQPLFDKRREFITGDVEPTDAESAWHSENEEEDKLAGDMK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 43 kDa
• Gene Name: nucleosome assembly protein 1 like 4
• Database Link:
  NP_005960
  Q99733
• Background: The function of this protein remains unknown.
• Synonyms: hNAP2; NAP1L4b; NAP2; NAP2L
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data