NAP1L4 (NM_005969) Human Recombinant Protein
SKU
TP301407
Recombinant protein of human nucleosome assembly protein 1-like 4 (NAP1L4), 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC201407 protein sequence
Red=Cloning site Green=Tags(s) MADHSFSDGVPSDSVEAAKNASNTEKLTDQVMQNPRVLAALQERLDNVPHTPSSYIETLPKAVKRRINAL KQLQVRCAHIEAKFYEEVHDLERKYAALYQPLFDKRREFITGDVEPTDAESEWHSENEEEEKLAGDMKSK VVVTEKAAATAEEPDPKGIPEFWFTIFRNVDMLSELVQEYDEPILKHLQDIKVKFSDPGQPMSFVLEFHF EPNDYFTNSVLTKTYKMKSEPDKADPFSFEGPEIVDCDGCTIDWKKGKNVTVKTIKKKQKHKGRGTVRTI TKQVPNESFFNFFNPLKASGDGESLDEDSEFTLASDFEIGHFFRERIVPRAVLYFTGEAIEDDDNFEEGE EGEEEELEGDEEGEDEDDAEINPKV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_005960 |
Locus ID | 4676 |
UniProt ID | Q99733 |
Cytogenetics | 11p15.4 |
RefSeq Size | 2564 |
RefSeq ORF | 1125 |
Synonyms | hNAP2; NAP1L4b; NAP2; NAP2L |
Summary | This gene encodes a member of the nucleosome assembly protein (NAP) family which can interact with both core and linker histones. It can shuttle between the cytoplasm and nucleus, suggesting a role as a histone chaperone. This gene is one of several located near the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. [provided by RefSeq, Jul 2008] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH301407 | NAP1L4 MS Standard C13 and N15-labeled recombinant protein (NP_005960) | 10 ug |
$3,255.00
|
|
LC416953 | NAP1L4 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY416953 | Transient overexpression lysate of nucleosome assembly protein 1-like 4 (NAP1L4) | 100 ug |
$436.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.