NAP1L4 (NM_005969) Human Mass Spec Standard

SKU
PH301407
NAP1L4 MS Standard C13 and N15-labeled recombinant protein (NP_005960)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201407]
Predicted MW 42.8 kDa
Protein Sequence
Protein Sequence
>RC201407 protein sequence
Red=Cloning site Green=Tags(s)

MADHSFSDGVPSDSVEAAKNASNTEKLTDQVMQNPRVLAALQERLDNVPHTPSSYIETLPKAVKRRINAL
KQLQVRCAHIEAKFYEEVHDLERKYAALYQPLFDKRREFITGDVEPTDAESEWHSENEEEEKLAGDMKSK
VVVTEKAAATAEEPDPKGIPEFWFTIFRNVDMLSELVQEYDEPILKHLQDIKVKFSDPGQPMSFVLEFHF
EPNDYFTNSVLTKTYKMKSEPDKADPFSFEGPEIVDCDGCTIDWKKGKNVTVKTIKKKQKHKGRGTVRTI
TKQVPNESFFNFFNPLKASGDGESLDEDSEFTLASDFEIGHFFRERIVPRAVLYFTGEAIEDDDNFEEGE
EGEEEELEGDEEGEDEDDAEINPKV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005960
RefSeq Size 2564
RefSeq ORF 1125
Synonyms hNAP2; NAP1L4b; NAP2; NAP2L
Locus ID 4676
UniProt ID Q99733
Cytogenetics 11p15.4
Summary This gene encodes a member of the nucleosome assembly protein (NAP) family which can interact with both core and linker histones. It can shuttle between the cytoplasm and nucleus, suggesting a role as a histone chaperone. This gene is one of several located near the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:NAP1L4 (NM_005969) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416953 NAP1L4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416953 Transient overexpression lysate of nucleosome assembly protein 1-like 4 (NAP1L4) 100 ug
$436.00
TP301407 Recombinant protein of human nucleosome assembly protein 1-like 4 (NAP1L4), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.