OriGene Logo

CHCHD6 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA342947
Rabbit Polyclonal Anti-CHCHD6 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY410180 Transient overexpression lysate of coiled-coil-helix-coiled-coil-helix domain containing 6 (CHCHD6) 100 ug
$436.00
TP302975 Recombinant protein of human coiled-coil-helix-coiled-coil-helix domain containing 6 (CHCHD6), 20 µg
20 ug
$737.00

View other "CHCHD6 or NM_032343" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CHCHD6 antibody: synthetic peptide directed towards the N terminal of human CHCHD6. Synthetic peptide located within the following region: LPRSGSSGGQQPSGMKEGVKRYEQEHAAIQDKLFQVAKREREAATKHSKA
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 26 kDa
Gene Name coiled-coil-helix-coiled-coil-helix domain containing 6
Database Link
Background The function remains unknown.
Synonyms CHCM1; Mic25; PPP1R23
Note Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 90%; Guinea pig: 90%; Rabbit: 85%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.