OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CHCHD6 (NM_032343) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP302975
Recombinant protein of human coiled-coil-helix-coiled-coil-helix domain containing 6 (CHCHD6), 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA320046 Rabbit Polyclonal CHCHD6 Antibody
100 ug
$640.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CHCHD6 or NM_032343"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202975 protein sequence
Red=Cloning site Green=Tags(s)

MGSTESSEGRRVSFGVDEEERVRVLQGVRLSENVVNRMKEPSSPPPAPTSSTFGLQDGNLRAPHKESTLP
RSGSSGGQQPSGMKEGVKRYEQEHAAIQDKLFQVAKREREAATKHSKASLPTGEGSISHEEQKSVRLARE
LESREAELRRRDTFYKEQLERIERKNAEMYKLSSEQFHEAASKMESTIKPRRVEPVCSGLQAQILHCYRD
RPHEVLLCSDLVKAYQRCVSAAHKG

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 26.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_115719
Locus ID 84303
UniProt ID Q9BRQ6
Cytogenetics 3q21.3
RefSeq Size 1020
RefSeq ORF 705
Synonyms CHCM1; Mic25; MICOS25; PPP1R23
Summary Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CHCHD6" proteins (3)
SKU Description Size Price
PH302975 CHCHD6 MS Standard C13 and N15-labeled recombinant protein (NP_115719) 10 ug
$3,360.00
LC410180 Lyophilized CHCHD6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410180 Transient overexpression lysate of coiled-coil-helix-coiled-coil-helix domain containing 6 (CHCHD6) (as WB positive control) 100 ug
$436.00

file-alt Citations

A CHCHD6-APP axis connects amyloid and mitochondrial pathology in Alzheimer's disease
Shang, Sun, Chen et al
Acta Neuropathol (2022) 144 (5), 911-938 DOI: 10.1007/s00401-022-02499-0
Cited by 14
AI Summary: In this study, the CHCHD6 recombinant protein (TP302975) from OriGene was used to investigate the mechanistic link between APP processing and mitochondrial dysfunction in Alzheimer's disease.
Snippet: …CHCHD6 recombinant protein (TP302975) was from Origene (Rockville, MD, USA). …CHCHD6 recombinant protein (TP302975) was from Origene (Rockville, MD, USA). …
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products