MRGPRF Rabbit Polyclonal Antibody

CAT#: TA342778

Rabbit Polyclonal Anti-MRGPRF Antibody

Product Images

WB Suggested Anti-MRGPRF Antibody; Titration: 1.0 ug/ml; Positive Control: NCI-H226 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MRGPRF antibody: synthetic peptide directed towards the C terminal of human MRGPRF. Synthetic peptide located within the following region: PCLALILHVECRARRRQRSAKLNHVILAMVSVFLVSSIYLGIDWFLFWVF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: MAS related GPR family member F
• Database Link:
  NP_659452
  Entrez Gene 116535 Human
  UniProt ID Q96AM1
• Background: MRGPRF is an orphan receptor. It may bind to a neuropeptide and may regulate nociceptor function and/or development, including the sensation or modulation of pain.
• Synonyms: GPR140; GPR168; MRGF; RTA
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 93%; Guinea pig: 93%