RALA Rabbit Polyclonal Antibody

CAT#: TA342246

Rabbit polyclonal Anti-RALA Antibody

Product Images

WB Suggested Anti-RALA Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: MCF7 cell lysateRALA is supported by BioGPS gene expression data to be expressed in MCF7

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RALA antibody: synthetic peptide directed towards the middle region of human RALA. Synthetic peptide located within the following region: GQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: RALA Ras like proto-oncogene A
• Database Link:
  NP_005393
  Entrez Gene 5898 Human
  UniProt ID P11233
• Background: The product ofThis gene belongs toThe small GTPase superfamily, Ras family of proteins. GTP-binding proteins mediateThe transmembrane signaling initiated byThe occupancy of certain cell surface receptors.This gene encodes a low molecular mass ras-like GTP-binding protein that shares about 50% similarity with other ras proteins. [provided by RefSeq, Jul 2008]
• Synonyms: RAL
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Pancreatic cancer, Pathways in cancer