RAB1A Rabbit Polyclonal Antibody

CAT#: TA342210

Rabbit polyclonal Anti-RAB1A Antibody

Product Images

WB Suggested Anti-RAB1A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Muscle

• 

  Sample Type: 1. Human Cervical Cancer Cell Lysate (15ug); 2. Monkey Fibroblast Cell Lysate (15ug); 3. Human Cervical Cancer Cell transfected with Rab1A-GFP (15ug); Primary Dilution: 1:1000; Secondary Antibody: goat anti-Rabbit; Secondary Dilution: 1:40,00

• 

  Host: Rabbit; Target Name: RAB1A; Sample Tissue: HepG2; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: RAB1A; Sample Tissue: HepG2; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide ; Primary Antibody Concentration:2 ug/ml; Peptide Concentration: 5.0 ug/ml; Lysate Quantity: 25ug/lane/lane; Gel Concentration: 12%

• 

  Rabbit Anti-RAB1A Antibody;Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue; Observed Staining: Cytoplasmic in excellent staining; Primary Antibody Concentration: 1:100; Secondary Antibody: Donkey anti-Rabbit-Cy3; Secondary Antib

Show all 5 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RAB1A antibody: synthetic peptide directed towards the middle region of human RAB1A. Synthetic peptide located within the following region: AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: RAB1A, member RAS oncogene family
• Database Link:
  NP_004152
  Entrez Gene 19324 MouseEntrez Gene 5861 Human
  UniProt ID P62820
• Background: This gene encodes a member ofThe Ras superfamily of GTPases. Members ofThe gene family cycle between inactive GDP-bound and active GTP-bound forms.This small GTPase controls vesicle traffic fromThe endoplasmic reticulum toThe Golgi apparatus. Multiple alternatively spliced transcript variants have been identified forThis gene which encode different protein isoforms. [provided by RefSeq, Oct 2008]
• Synonyms: RAB1; YPT1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%

Reference Data

• Protein Families: Druggable Genome