RAB1A Rabbit Polyclonal Antibody

SKU TA342210

Rabbit polyclonal Anti-RAB1A Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RAB1A antibody: synthetic peptide directed towards the middle region of human RAB1A. Synthetic peptide located within the following region: AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 23 kDa
• Gene Name: RAB1A, member RAS oncogene family
• Database Link:
  NP_004152
  P62820
• Background: This gene encodes a member ofThe Ras superfamily of GTPases. Members ofThe gene family cycle between inactive GDP-bound and active GTP-bound forms.This small GTPase controls vesicle traffic fromThe endoplasmic reticulum toThe Golgi apparatus. Multiple alternatively spliced transcript variants have been identified forThis gene which encode different protein isoforms. [provided by RefSeq, Oct 2008]
• Synonyms: RAB1; YPT1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%

Reference Data

• Protein Families: Druggable Genome