RAB1A (NM_004161) Human Recombinant Protein

  • Product Brand Image
SKU
TP301640
Recombinant protein of human RAB1A, member RAS oncogene family (RAB1A), transcript variant 1, 20 µg
In Control Promo
  $737.00
4 Weeks*
Bulk/Customize
Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201640 protein sequence
Red=Cloning site Green=Tags(s)

MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQ
ERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAK
EFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 22.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004152
Locus ID 5861
UniProt ID P62820
Cytogenetics 2p14
RefSeq Size 2648
RefSeq ORF 615
Synonyms RAB1; YPT1
Summary This gene encodes a member of the Ras superfamily of GTPases. Members of the gene family cycle between inactive GDP-bound and active GTP-bound forms. This small GTPase controls vesicle traffic from the endoplasmic reticulum to the Golgi apparatus. Multiple alternatively spliced transcript variants have been identified for this gene which encode different protein isoforms. provided by RefSeq, Oct 2008
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "RAB1A" proteins (3)
SKU Description Size Price
PH301640 RAB1A MS Standard C13 and N15-labeled recombinant protein (NP_004152) 10 ug
$3,360.00
LC401338 RAB1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401338 Transient overexpression lysate of RAB1A, member RAS oncogene family (RAB1A), transcript variant 1 100 ug
$436.00
OriGene AI

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.