IRF1 Rabbit Polyclonal Antibody

CAT#: TA341785

Rabbit Polyclonal Anti-Irf1 Antibody

Product Images

WB Suggested Anti-Irf1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Mouse Uterus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Irf1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DIIPDSTTDLYNLQVSPMPSTSEAATDEDEEGKIAEDLMKLFEQSEWQPT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: interferon regulatory factor 1
• Database Link:
  NP_002189
  Entrez Gene 16362 Mouse
  UniProt ID P10914
• Background: Irf1 specifically binds toThe upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)) and activates those genes.Irf1 acts as a tumor suppressor.
• Synonyms: IRF-1; MAR
• Note: Immunogen Sequence Homology: Mouse: 100%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Sheep: 85%; Bovine: 85%; Rabbit: 85%; Dog: 83%; Horse: 83%; Human: 83%; Yeast: 83%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors