IRF1 Rabbit Polyclonal Antibody

SKU
TA341785
Rabbit Polyclonal Anti-Irf1 Antibody
  $585.00
5 Days*
Bulk/Customize
Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Irf1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DIIPDSTTDLYNLQVSPMPSTSEAATDEDEEGKIAEDLMKLFEQSEWQPT
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 37 kDa
Gene Name interferon regulatory factor 1
Database Link
Background Irf1 specifically binds toThe upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)) and activates those genes.Irf1 acts as a tumor suppressor.
Synonyms IRF-1; MAR
Note Immunogen Sequence Homology: Mouse: 100%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Sheep: 85%; Bovine: 85%; Rabbit: 85%; Dog: 83%; Horse: 83%; Human: 83%; Yeast: 83%
Reference Data
Protein Categories Cancer: Lung, Growth Factors, Intracellular Proteins, Transciption Factors
Protein Families Druggable Genome, Transcription Factors
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.