IRF1 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Mouse |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-Irf1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: HIDGKGYLLNEPGTQLSSVYGDFSCKEEPEIDSPRGDIGIGIQHVFTEMK |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 37 kDa |
| Gene Name | interferon regulatory factor 1 |
| Database Link | |
| Background | Irf1 specifically binds toThe upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)) and activates those genes. Irf1 acts as a tumor suppressor. |
| Synonyms | IRF-1; MAR |
| Note | Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Human: 93%; Sheep: 90%; Bovine: 90%; Pig: 86%; Rabbit: 86%; Guinea pig: 86%; Dog: 80% |
| Reference Data | |
| Protein Categories | Cancer: Lung, Growth Factors, Intracellular Proteins, Transciption Factors |
| Protein Families | Druggable Genome, Transcription Factors |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.