NEU4 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-NEU4 antibody: synthetic peptide directed towards the N terminal of human NEU4. Synthetic peptide located within the following region: TGTVFLFFIAVLGHTPEAVQIATGRNAARLCCVASRDAGLSWGSARDLTE |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 53 kDa |
| Gene Name | neuraminidase 4 (sialidase) |
| Database Link | |
| Background | NEU4 belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids.This gene belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. |
| Synonyms | FLJ35928; MGC18222; MGC102757 |
| Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Guinea pig: 93% |
| Reference Data | |
| Protein Categories | Intracellular Proteins |
| Protein Pathways | Other glycan degradation, Sphingolipid metabolism |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
Therapeutic Effect of Neuraminidase-1-Selective Inhibition in Mouse Models of Bleomycin-Induced Pulmonary Inflammation and Fibrosis
Luzina, Lillehoj, Lockatell et al
J Pharmacol Exp Ther (2021) 376 (1), 136-146 DOI: 10.1124/jpet.120.000223
Luzina, Lillehoj, Lockatell et al
J Pharmacol Exp Ther (2021) 376 (1), 136-146 DOI: 10.1124/jpet.120.000223
Cited by 35
AI Summary: In this study, OriGene’s products—specifically the NEU1 (NM_006656) and PPCA (NM_000308) qPCR primer sets—were used to quantify gene expression levels in human and mouse lung tissues, helping to demonstrate elevated NEU1 and PPCA mRNA in pulmonary fibrosis models and thereby supporting the therapeutic targeting of NEU1.
Attenuated pulmonary fibrosis in sialidase-3 knockout (Neu3-/-) mice
Karhadkar, Chen, Gomer
Am J Physiol Lung Cell Mol Physiol (2020) 318 (1), L165-L179 DOI: 10.1152/ajplung.00275.2019
Karhadkar, Chen, Gomer
Am J Physiol Lung Cell Mol Physiol (2020) 318 (1), L165-L179 DOI: 10.1152/ajplung.00275.2019
Cited by 34
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
