NCE2 (UBE2F) Rabbit Polyclonal Antibody

SKU
TA340245
Rabbit Polyclonal Anti-UBE2F Antibody
  $585.00
5 Days*
Bulk/Customize
Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-UBE2F antibody: synthetic peptide directed towards the middle region of human UBE2F. Synthetic peptide located within the following region: TLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYA
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 21 kDa
Gene Name ubiquitin conjugating enzyme E2 F (putative)
Database Link
Background UBE2F belongs to the ubiquitin-conjugating enzyme family. UBE2F accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins.
Synonyms NCE2
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 79%
Reference Data
Protein Categories Intracellular Proteins
Protein Pathways Ubiquitin mediated proteolysis
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.