CTRP4 (C1QTNF4) Rabbit Polyclonal Antibody

SKU TA340207

Rabbit Polyclonal Anti-C1QTNF4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C1QTNF4 antibody: synthetic peptide directed towards the middle region of human C1QTNF4. Synthetic peptide located within the following region: DEQRRPGARRAASQSAMLQLDYGDTVWLRLHGAPQYALGAPGATFSGYLV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 35 kDa
• Gene Name: C1q and tumor necrosis factor related protein 4
• Database Link:
  NP_114115
  Q9BXJ3
• Background: The specific function of C1QTNF4 is not yet known.
• Synonyms: CTRP4; ZACRP4
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Secreted Protein