OriGene Logo

CTRP4 (C1QTNF4) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA340207
Rabbit Polyclonal Anti-C1QTNF4 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY410444 Transient overexpression lysate of C1q and tumor necrosis factor related protein 4 (C1QTNF4) 100 ug
$436.00
TP307458 Recombinant protein of human C1q and tumor necrosis factor related protein 4 (C1QTNF4), 20 µg
20 ug
$867.00

View other "CTRP4 or NM_031909" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-C1QTNF4 antibody: synthetic peptide directed towards the middle region of human C1QTNF4. Synthetic peptide located within the following region: DEQRRPGARRAASQSAMLQLDYGDTVWLRLHGAPQYALGAPGATFSGYLV
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 35 kDa
Gene Name C1q and tumor necrosis factor related protein 4
Database Link
Background The specific function of C1QTNF4 is not yet known.
Synonyms CTRP4; ZACRP4
Note Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Guinea pig: 93%
Reference Data
Protein Categories Cytokines, Secreated Proteins
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.