CPLX2 Rabbit Polyclonal Antibody

CAT#: TA340129

Rabbit Polyclonal Anti-CPLX2 Antibody

Product Images

WB Suggested Anti-CPLX2 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CPLX2 antibody: synthetic peptide directed towards the N terminal of human CPLX2. Synthetic peptide located within the following region: MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 15
• Gene Name: complexin 2
• Database Link:
  NP_006641
  Entrez Gene 10814 Human
  UniProt ID Q6PUV4
• Background: Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. Two transcript variants encoding the same protein have been found for this gene.
• Synonyms: 921-L; CPX-2; CPX2; Hfb1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome