OriGene Logo

CPLX2 (NM_006650) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP310806
Recombinant protein of human complexin 2 (CPLX2), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
In Control Promo
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA340129 Rabbit Polyclonal Anti-CPLX2 Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CPLX2 or NM_006650"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210806 protein sequence
Red=Cloning site Green=Tags(s)

MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKY
GLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 15.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006641
Locus ID 10814
UniProt ID Q6PUV4
Cytogenetics 5q35.2
RefSeq Size 4726
RefSeq ORF 402
Synonyms 921-L; CPX-2; CPX2; Hfb1
Summary Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. Two transcript variants encoding the same protein have been found for this gene. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "CPLX2" proteins (8)
SKU Description Size Price
PH310806 CPLX2 MS Standard C13 and N15-labeled recombinant protein (NP_006641) 10 ug
$3,360.00
PH321947 CPLX2 MS Standard C13 and N15-labeled recombinant protein (NP_001008221) 10 ug
$3,360.00
LC416505 CPLX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423397 CPLX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416505 Transient overexpression lysate of complexin 2 (CPLX2), transcript variant 1 100 ug
$436.00
LY423397 Transient overexpression lysate of complexin 2 (CPLX2), transcript variant 2 100 ug
$436.00
TP321947 Recombinant protein of human complexin 2 (CPLX2), transcript variant 2, 20 µg 20 ug
$867.00
TP710112 Recombinant protein of human human complexin 2 (CPLX2), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9 cells 20 ug
$540.00
OriGene AI

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.