CPLX2 (NM_006650) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC210806] |
Predicted MW | 15.4 kDa |
Protein Sequence |
Protein Sequence
>RC210806 protein sequence
Red=Cloning site Green=Tags(s) MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKY GLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_006641 |
RefSeq Size | 4726 |
RefSeq ORF | 402 |
Synonyms | 921-L; CPX-2; CPX2; Hfb1 |
Locus ID | 10814 |
UniProt ID | Q6PUV4 |
Cytogenetics | 5q35.2 |
Summary | Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH321947 | CPLX2 MS Standard C13 and N15-labeled recombinant protein (NP_001008221) | 10 ug |
$3,255.00
|
|
LC416505 | CPLX2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC423397 | CPLX2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY416505 | Transient overexpression lysate of complexin 2 (CPLX2), transcript variant 1 | 100 ug |
$436.00
|
|
LY423397 | Transient overexpression lysate of complexin 2 (CPLX2), transcript variant 2 | 100 ug |
$436.00
|
|
TP310806 | Recombinant protein of human complexin 2 (CPLX2), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP321947 | Recombinant protein of human complexin 2 (CPLX2), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP710112 | Recombinant protein of human human complexin 2 (CPLX2), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9 cells | 20 ug |
$515.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.